SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010872144.1.35395 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010872144.1.35395
Domain Number 1 Region: 397-479
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000143
Family Anti-sigma factor antagonist SpoIIaa 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010872144.1.35395
Sequence length 498
Comment sodium-independent anion transporter [Synechocystis sp. PCC 6803]; AA=GCF_000009725.1; RF=na; TAX=1148; STAX=1148; NAME=Synechocystis sp. PCC 6803; strain=PCC 6803; AL=Complete Genome; RT=Major
Sequence
MINWTILKREWFRNTKEDLLAGAVVGLALIPEAIAFSIIAGVDPKVGLYASFTIAVLTAF
FGGRSGSISAATGAMALLMVDLVKDHGLQYLLAATVLTGIFQVLLGVFKVAKQMRYVPRA
VVLGYINALAVLIFLAQLPQLDPTKVSQYWLVYLILACSLAIIYILPTFTKVFPSPLVAL
FVMTNATIFLQLDVPTVGDMGELPGSLPIFLLPQIPFNWQTLQIILPYSLTLAIVGLLAS
FLTASLVDELTDTPSDKNREAKGQGIANIVTGFFGGMAGCGMIGQSVINVQSGGRGRLST
FAAGIFLLIAILGLKDWVQQMPMATLVAVMIMVSIGTFRWSSLRDFRKIPQSENIVMFTT
MGLIIITRNFALGVAAGIIMSTIFFTRKIAQLVFVDRVLTEDENHRIYNVSGQIFFVSKE
EFLEAFDFDELVDRVTIDLTHAHLWDQGAVGTVEQIMTKFRRNGIDVELVGLNGASATLW
QKLIKEPELKLINSSAEN
Download sequence
Identical sequences L8AI13 P73474
gi|16330106|ref|NP_440834.1| gi|383490902|ref|YP_005408578.1| gi|383321849|ref|YP_005382702.1| GO.8926 gi|16330106|ref|NP_440834.1| WP_010872144.1.11876 WP_010872144.1.1889 WP_010872144.1.18904 WP_010872144.1.33690 WP_010872144.1.35395 WP_010872144.1.47586 WP_010872144.1.99424 1148.slr1229 gi|383325018|ref|YP_005385871.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]