SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010872342.1.1889 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010872342.1.1889
Domain Number 1 Region: 33-114
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.00000000000458
Family MoCo biosynthesis proteins 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010872342.1.1889
Sequence length 208
Comment 7-carboxy-7-deazaguanine synthase QueE [Synechocystis sp. PCC 6803]; AA=GCF_000340785.1; RF=na; TAX=1148; STAX=1148; NAME=Synechocystis sp. PCC 6803; strain=PCC 6803; AL=Complete Genome; RT=Major
Sequence
MSMGPISELLTVSYPIAETFHSLQGEGAWAGGNAFFIRLGGCDVHCPWCDQKETWPTQHH
PRQTVTELVQQAVTAKPSFVVITGGEPLMHDLQPLCKTLKNQGLRLHLETSGAYPLTGQF
DWITLSPKPYKLPQAAIYPLANELKVIISQDEDFDWAEMEARKISPGTPLYLQAEWETEA
MNEKIFAYILTHSQWRLSLQTHKYLGVR
Download sequence
Identical sequences L8AIZ7 P73667
gi|16330304|ref|NP_441032.1| gi|383491098|ref|YP_005408774.1| 1148.sll2011 WP_010872342.1.11876 WP_010872342.1.1889 WP_010872342.1.18904 WP_010872342.1.33690 WP_010872342.1.35395 WP_010872342.1.47586 WP_010872342.1.99424 gi|383322045|ref|YP_005382898.1| gi|383325214|ref|YP_005386067.1| gi|16330304|ref|NP_441032.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]