SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010872693.1.47586 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010872693.1.47586
Domain Number 1 Region: 5-360
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 2.22e-109
Family Dehydroquinate synthase, DHQS 0.00000576
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010872693.1.47586
Sequence length 361
Comment 3-dehydroquinate synthase [Synechocystis sp. PCC 6803]; AA=GCF_001318385.1; RF=na; TAX=1148; STAX=1148; NAME=Synechocystis sp. PCC 6803; strain=PCC 6803 substr. GT-G; AL=Complete Genome; RT=Major
Sequence
MATTIPVPLPQSPYQVQIVPGGLAAIADHLAPLGLGKKIMVVSNPEIYDYYGEVVIQALQ
RAGYEVFQHLIPAGETHKTLASINELYDVAFQANLERNSTLLSLGGGVIGDMTGFGAATW
LRGINFVQVPTSLLAMVDASIGGKTGVNHPQGKNLIGAFYQPRLVYIDPVVLKTLPEREF
RAGMAEVIKYGVIWDSELFTALEEAEDLSSIDRLPDELLTKIIQRSCQAKVDVVSQDEKE
AGLRAILNYGHTVGHGVESLTGYGVINHGEAVAIGMEAAAKIAHYLGLCDQSLGDRQRQL
LLKTKLPTEMPPTLAVENLLASLLHDKKVKAGKVRFILPTAIGQVTISDAVTDEVIKATL
G
Download sequence
Identical sequences L8AJW9 P73997
1148.slr2130 gi|16330660|ref|NP_441388.1| WP_010872693.1.11876 WP_010872693.1.1889 WP_010872693.1.18904 WP_010872693.1.33690 WP_010872693.1.35395 WP_010872693.1.47586 WP_010872693.1.99424 gi|383325571|ref|YP_005386424.1| gi|383322402|ref|YP_005383255.1| gi|383491455|ref|YP_005409131.1| gi|16330660|ref|NP_441388.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]