SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010872839.1.1889 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010872839.1.1889
Domain Number 1 Region: 39-483
Classification Level Classification E-value
Superfamily ADC synthase 8.63e-135
Family ADC synthase 0.000000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010872839.1.1889
Sequence length 485
Comment anthranilate synthase component I-like protein [Synechocystis sp. PCC 6803]; AA=GCF_000340785.1; RF=na; TAX=1148; STAX=1148; NAME=Synechocystis sp. PCC 6803; strain=PCC 6803; AL=Complete Genome; RT=Major
Sequence
MASIAHCSGGLVGAGNFDFILGGSDPVGRHGLMELQPWHWCCLPLEGRTGSEIFSQLFGH
QGIATLLESPYPASPDHPHLGRYSLCAGQPRKGRLWTPKPEEIFSFLNQLCPCNHDVNLT
KNIPEHLPFHGGWLGWLGYDTAWAIEKLPYSKADDLPFPVAYWYEPENFVILDHQEQLLW
LATTDQEKIKFFQTQLADKINSVSSPQVPPLNLTYTTDQDQYETMVNQAKQYIKAGDIFQ
ANLTLRFIAKTEQKLNSWQVYQHLQTINPSPFASYWRSPWGDVVSCSPERLVKLEGNVAQ
TRPIAGTRARGKNLAEDEQLLQELLVNTKELAEHIMLVDLERNDLGRVCTWGTVEVDELL
AIERYSHVSHLVSNVKGILQPDKTGVDLVKALFPGGTITGCPKIRCLEIIEELEPVRRSL
FYGSCGYWDQRGNLDLNILIRTLLFTSGQVTGQVGAGIVADSDPAKEWLESLQKAKALLA
ALEGL
Download sequence
Identical sequences P74130
gi|16330808|ref|NP_441536.1| gi|383322550|ref|YP_005383403.1| 1148.slr1979 gi|383491603|ref|YP_005409279.1| WP_010872839.1.11876 WP_010872839.1.1889 WP_010872839.1.18904 WP_010872839.1.33690 WP_010872839.1.35395 WP_010872839.1.47586 WP_010872839.1.99424 gi|16330808|ref|NP_441536.1| gi|383325719|ref|YP_005386572.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]