SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010873796.1.18904 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010873796.1.18904
Domain Number 1 Region: 446-536
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000647
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010873796.1.18904
Sequence length 556
Comment sodium-independent anion transporter [Synechocystis sp. PCC 6803]; AA=GCF_000284215.1; RF=na; TAX=1080229; STAX=1148; NAME=Synechocystis sp. PCC 6803 substr. PCC-N; strain=PCC 6803 substr. PCC-N; AL=Complete Genome; RT=Major
Sequence
MATTLLSPTRFVHGLRFDNLRGDIFGGITAAIVALPLALAFGVASGAGPIAGLYGAICTG
FFAALFGGTPAQISGPTGPMTVVMASTFANLTASNPENGWAMALTVVMFGGIFQVVLGLL
GLGKYITFMPYTVISGFMSGIGVIIVILQIAPLLGHQTAPGVVPSLQAIPTYLNDVNFAA
LGLGLIALAIVFFSPPRLNRILPAPLIALVLGTIISMIFFGNVSLPRIGEIPSGLPSLHL
PYLSWGSLQQMLLYSIMLAVLGSLDSLLTSLVADNISRSHHDSDRELVGQGIGNLVSGLC
GGLPGAGATMRTVININSGGKTPIAGMIHALILLMIVLKAGQLTEPIPHAVLAGILIKVG
IDIVDWSFLKRAHQLSTKGAGLMYLVLGLTVFVDLITAVAVGVFVANLFTVKNLTDLQLE
SIKSVTRADGEDWLLEEEQQILRAANGRIFMFHLSGPMSFGAAKSIARRLAIVENYDVLI
LDLATVPRLGVTALLAIETMLKDALAKQREVFLVGAKGQVQARLQRLPVLAQLSPHHRLE
SRLLALQMAAVCINVD
Download sequence
Identical sequences L8AQV4 Q55814
gi|383492566|ref|YP_005410243.1| gi|383323513|ref|YP_005384367.1| WP_010873796.1.11876 WP_010873796.1.1889 WP_010873796.1.18904 WP_010873796.1.33690 WP_010873796.1.35395 WP_010873796.1.47586 WP_010873796.1.99424 GO.8933 gi|383326682|ref|YP_005387536.1| gi|16331770|ref|NP_442498.1| gi|16331770|ref|NP_442498.1| 1148.slr0096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]