SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010873822.1.47586 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010873822.1.47586
Domain Number 1 Region: 474-654
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.17e-47
Family Histidine kinase 0.00067
Further Details:      
 
Domain Number 2 Region: 408-486
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.59e-22
Family Homodimeric domain of signal transducing histidine kinase 0.00081
Further Details:      
 
Domain Number 3 Region: 291-400
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000166
Family Heme-binding PAS domain 0.055
Further Details:      
 
Weak hits

Sequence:  WP_010873822.1.47586
Domain Number - Region: 674-798
Classification Level Classification E-value
Superfamily CheY-like 0.000327
Family CheY-related 0.011
Further Details:      
 
Domain Number - Region: 65-103
Classification Level Classification E-value
Superfamily Sensory domain-like 0.051
Family Sensory domain of two-component sensor kinase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010873822.1.47586
Sequence length 806
Comment PAS domain-containing sensor histidine kinase [Synechocystis sp. PCC 6803]; AA=GCF_001318385.1; RF=na; TAX=1148; STAX=1148; NAME=Synechocystis sp. PCC 6803; strain=PCC 6803 substr. GT-G; AL=Complete Genome; RT=Major
Sequence
MVQEKPRFTRPLRYQLLAGCALILMITSAIAVVLTRQQLQEKSRINIITRAQRLTEGLEF
AAEGLVETKDVYRLNRLAQNYATWPNVQTISIVDPNGILIAHGGEIKMVRGEKYAQVTPA
LFPIFEQVSISGIPQSLITQIEEEEVVVYALPFNTYSFPEQGESYRDQNSHRRGVAITIL
SKQELNREVNQGLLLVVGSFIIGIVVILLLLGLLIRYAVLLPLGKLHRALINYDNTEQFN
LPPLPSNEIGFLGQTLVQTFNQLQIYQREALEIAERKYVEIAQRYELASQATRVWVWECQ
PKIHYFEVDPNLITWLGFEQPLEPADGDFFIHLGDRPMFWQAIEQSLEDPTMELSTELRL
EAANGEIYHCLLRGQIHQEQGEAFVKIIGTIADITEIKKAEEQLKLSNKILAKATQLKDE
FLANMSHELRTPLNSILGMIETLQNQVYGPLNGKQVQSLEIVENSGRHLLSLINDILDLS
KIEAGRMDLDLNPTSVSALVNHSLTFVQQFAIQKQINLSSEIIPNLPDVLVDKRRLCQVL
INLLNNAIKFTPEGGKVVVQADLIKEQGKENSQSPPQLSFTVFDTGIGIEADRLNNIFEP
FVQIDSALNRRYDGTGLGLSLVKKIVELHGGSVTVTSKLNEGSRFKITIPCVFQDKDGPR
HRGQLVEVTNHGSPTPIIITLISKNSAYATTLSSYFRAKGYQMQWLNCLYPTAAELTQLV
KIGDQSCHVLVMDLANTGEEVKDKLDEIRKFFGSSPITIIALVDATEQTKSNIAQLEIAT
NELLVKPVRFHRLMEIVREETCPVPR
Download sequence
Identical sequences L8AP85 Q55838
gi|383326708|ref|YP_005387562.1| gi|16331796|ref|NP_442524.1| 1148.sll0474 gi|383323539|ref|YP_005384393.1| gi|383492592|ref|YP_005410269.1| WP_010873822.1.11876 WP_010873822.1.1889 WP_010873822.1.18904 WP_010873822.1.33690 WP_010873822.1.35395 WP_010873822.1.47586 WP_010873822.1.99424 gi|16331796|ref|NP_442524.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]