SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010886499.1.39605 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010886499.1.39605
Domain Number 1 Region: 324-678
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.22e-63
Family beta-Lactamase/D-ala carboxypeptidase 0.0034
Further Details:      
 
Domain Number 2 Region: 40-102,193-322
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.23e-33
Family Penicillin binding protein dimerisation domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010886499.1.39605
Sequence length 685
Comment MULTISPECIES: penicillin-binding protein [Bacillus]; AA=GCF_001541905.1; RF=na; TAX=135461; STAX=1423; NAME=Bacillus subtilis subsp. subtilis; strain=CU1050; AL=Complete Genome; RT=Major
Sequence
MNLFFLAVFVLFTALIFKLGVVQIVEGEQHEEDAEKSNAKTAYYPAPRGKMYDRNQKVAV
DNQSVPEIVYVSTSSTKTEDKIKTAKRLASFIHIDTEFLKERDLRDYWIAAHPKKAAALL
KESESNLKGDQAYKLQIERVPDQELKAIQQDDEEMETAAIYTRFSSGNAYEPQIVKAMNP
NKSNSNGKNGALLDEKKNSSQRPKNDLTYDEISIVSEHLEELPGIDIVNDWTRKYPYDKT
LYSVFGGVTTPDQGLLSDRKDFYLTRGYANNDRVGKSYLEYQYEEYLNSHKEKVEYVEDN
KGNVVSQKTIDKGSRGYDLQLSFDMELQAKVEKIIEEEVRNSRARGNYMLDRAFAVMMDP
NNGDILSMAGKKIDLKTNKIEDYAIGAFTTQYEMGSAVKGATVLAGYQDGIPHYKYYIDA
PMLLGTNLIKKSYTNMGTINELTALQKSSNVYMFNVAMHIAGVTYKPHGSLPADQNDLLK
MRNYYSQFGLGVKTGIDLPQESAGMQTTPKTVGGLILDLAIGQYDTYTPLQMAQYISVIA
NGGYRVQPRIVTSIHKPGKKDQLGKAIEHRKPKVLNKINNSESDLKQVQTGMKLVTSSGT
AKNTFTEDVSGKTGTAETFYYGTNRNWWGKKTYNLTFVGYYPSKKPKVAFSVVVPSVDDD
DKINKIIAKRAIHAYAELEKKHSKK
Download sequence
Identical sequences gi|470161575|ref|YP_007533350.1| NP_389281.1.22788 WP_010886499.1.11257 WP_010886499.1.1140 WP_010886499.1.12759 WP_010886499.1.15902 WP_010886499.1.16291 WP_010886499.1.19261 WP_010886499.1.27372 WP_010886499.1.27660 WP_010886499.1.2914 WP_010886499.1.32219 WP_010886499.1.32420 WP_010886499.1.33846 WP_010886499.1.36189 WP_010886499.1.39605 WP_010886499.1.40859 WP_010886499.1.44140 WP_010886499.1.44184 WP_010886499.1.45019 WP_010886499.1.47157 WP_010886499.1.56274 WP_010886499.1.56411 WP_010886499.1.57201 WP_010886499.1.5726 WP_010886499.1.57513 WP_010886499.1.6139 WP_010886499.1.6517 WP_010886499.1.65223 WP_010886499.1.72999 WP_010886499.1.76977 WP_010886499.1.78686 WP_010886499.1.81116 WP_010886499.1.81747 WP_010886499.1.82722 WP_010886499.1.88042 WP_010886499.1.91723 WP_010886499.1.93420 WP_010886499.1.94199 WP_010886499.1.96043 WP_010886499.1.979 gi|16078462|ref|NP_389281.1| 224308.BSU13980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]