SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010888773.1.45201 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010888773.1.45201
Domain Number 1 Region: 92-151
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000811
Family NfeD domain-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010888773.1.45201
Sequence length 159
Comment membrane protein [Deinococcus radiodurans]; AA=GCF_001638825.1; RF=na; TAX=243230; STAX=1299; NAME=Deinococcus radiodurans R1; strain=R1; AL=Complete Genome; RT=Major
Sequence
MPDWLPTWQAVHPWHWWVFGALLLILEILAPGVFFVWLALSAFGVGLLTFVLPFLDVPGQ
LLLFAGLSVAAVWLGRRYVSRLVLGGSEGEQLNTGAQRLIGRTVTVVTPIEHGVGRVRVG
DSDWRARGPELPAGTPVRIVGVEGATLVVQEEKRLVEAG
Download sequence
Identical sequences Q9RSI2
gi|15807136|ref|NP_295865.1| GO.2803 243230.DR_2142 NP_295865.1.55610 WP_010888773.1.45201 WP_010888773.1.61927 WP_010888773.1.86829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]