SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010906485.1.79593 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010906485.1.79593
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.85e-58
Family Ribonuclease H 0.00000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010906485.1.79593
Sequence length 154
Comment ribonuclease HI [Pasteurella multocida]; AA=GCF_001670535.1; RF=na; TAX=44283; STAX=747; NAME=Pasteurella multocida subsp. multocida; strain=ATCC 2095; AL=Scaffold; RT=Major
Sequence
MQKQIEIFTDGSCLGNPGPGGIGVLLRYKQHEKQISAGYFLTTNNRMELRAVIEALNTLK
EPCSVTLHSDSQYMKNGITKWIFNWKKNNWKASTGKPVKNQDLWIQLDQAIQRHHINWQW
VKGHSGHIENEICDQLAKAGAENPTLQDVGYQPE
Download sequence
Identical sequences P57813
WP_010906485.1.12311 WP_010906485.1.15732 WP_010906485.1.17980 WP_010906485.1.19996 WP_010906485.1.27592 WP_010906485.1.40210 WP_010906485.1.41351 WP_010906485.1.41657 WP_010906485.1.41667 WP_010906485.1.42512 WP_010906485.1.45422 WP_010906485.1.4808 WP_010906485.1.53852 WP_010906485.1.58111 WP_010906485.1.6219 WP_010906485.1.62389 WP_010906485.1.66990 WP_010906485.1.79593 WP_010906485.1.81885 WP_010906485.1.8281 WP_010906485.1.88402 WP_010906485.1.89773 WP_010906485.1.92478 WP_010906485.1.93940 WP_010906485.1.94432 WP_010906485.1.9746 WP_010906485.1.9947 272843.PM0107 gi|15601972|ref|NP_245044.1| gi|386834791|ref|YP_006240108.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]