SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010906524.1.58111 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010906524.1.58111
Domain Number 1 Region: 24-324
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.56e-63
Family Phosphate binding protein-like 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010906524.1.58111
Sequence length 342
Comment iron ABC transporter substrate-binding protein [Pasteurella multocida]; AA=GCF_001578435.1; RF=na; TAX=1455592; STAX=747; NAME=Pasteurella multocida subsp. multocida PMTB2.1; strain=PMTB2.1; AL=Complete Genome; RT=Major
Sequence
MKLKSTVSQLCLALPFVLTGQALAEGKLTVYCSVQNTTCEKMVQTFSKKYDIETKFIRNS
TGATLAKLMAEKNNPQADVWYGGTIEHHFQAGDLALLEPYRSPYQADIMPQFRALTEKRG
DLTSIVYMLVLGFGINTEKFKQLGIDTYPKCWSDLLDPRLQGYVQMPDPQISGTTYTAIA
TLIELWGEEKAFDYLKKLNANVSEYVKSALVTTNLSRGESAVAVGFVHSYATEKENGAPV
ESIQPCEGDGYSLGGMSIVKNARNLENAKRFVDWALTKEAQELVWRETKVYQIPTNIHAE
ASPQSVDPKQLKLINYDFDRFGSSAEGKRLTDKWVKEVKMAK
Download sequence
Identical sequences Q9CP55
WP_010906524.1.12311 WP_010906524.1.15732 WP_010906524.1.19996 WP_010906524.1.40210 WP_010906524.1.41351 WP_010906524.1.41667 WP_010906524.1.45422 WP_010906524.1.4808 WP_010906524.1.53852 WP_010906524.1.58111 WP_010906524.1.6219 WP_010906524.1.62389 WP_010906524.1.66990 WP_010906524.1.81885 WP_010906524.1.8281 WP_010906524.1.88402 WP_010906524.1.89773 WP_010906524.1.92478 WP_010906524.1.93940 WP_010906524.1.9746 WP_010906524.1.9947 272843.PM0203 gi|15602068|ref|NP_245140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]