SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010906642.1.89773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010906642.1.89773
Domain Number 1 Region: 262-422
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.93e-40
Family Histidine kinase 0.0015
Further Details:      
 
Domain Number 2 Region: 190-268
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 7.65e-16
Family Homodimeric domain of signal transducing histidine kinase 0.002
Further Details:      
 
Domain Number 3 Region: 96-195
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000819
Family Heme-binding PAS domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010906642.1.89773
Sequence length 431
Comment PAS domain-containing sensor histidine kinase [Pasteurella multocida]; AA=GCF_002024045.1; RF=na; TAX=115545; STAX=747; NAME=Pasteurella multocida subsp. septica; strain=CIRMBP-0906; AL=Scaffold; RT=Major
Sequence
MKRTFSIKYFFIELAISLLIASLFSYFTQSFTFWFIAVLLCFLIFHHYNEFKLLKMLYPD
ATDTLKKTHLLDNISQTTAYYKSKNRKERIKTLRLLSKLNKNIQYLPDAIIICDNEGNIS
WCNNASQEMFMFYWNKKINSKNLFNVIFYNEFKHYFYQSMRKRPLVLLTNENRYIEININ
HYDNESRVIIARDVTQMIRLLHSRQTFLSNINHELRTPLTVLQGYLELLEAEKDHSALAQ
KAIHAMQAQSQRMANLLQQLNVLAKIESSSNQEHEPVDMSRLILNLKENAHFLNHYHHQI
HFDIAPDIYVFGDESQLQSAVSNLIYNAIKHSGENCQINVSWQLCAEGAKFSVTDNGIGI
ATHHLYHLTERFYRVDESRSNQTGGHGLGLAIVKHALEQHHAQLEIESKEGEGSCFSFII
PKKLLCESASA
Download sequence
Identical sequences Q9CNJ9
gi|15602296|ref|NP_245368.1| WP_010906642.1.12311 WP_010906642.1.15732 WP_010906642.1.19996 WP_010906642.1.40210 WP_010906642.1.45422 WP_010906642.1.4808 WP_010906642.1.53852 WP_010906642.1.6219 WP_010906642.1.62389 WP_010906642.1.66990 WP_010906642.1.81885 WP_010906642.1.8281 WP_010906642.1.89773 WP_010906642.1.9746 WP_010906642.1.9947 272843.PM0431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]