SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010906805.1.9947 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010906805.1.9947
Domain Number 1 Region: 12-220
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.77e-65
Family DnaQ-like 3'-5' exonuclease 0.00000236
Further Details:      
 
Domain Number 2 Region: 204-310
Classification Level Classification E-value
Superfamily HRDC-like 2.06e-25
Family RNase D C-terminal domains 0.0005
Further Details:      
 
Domain Number 3 Region: 307-378
Classification Level Classification E-value
Superfamily HRDC-like 0.00000000000000828
Family RNase D C-terminal domains 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010906805.1.9947
Sequence length 383
Comment ribonuclease D [Pasteurella multocida]; AA=GCF_000412105.1; RF=na; TAX=1298928; STAX=747; NAME=Pasteurella multocida RIIF; strain=RIIF; AL=Contig; RT=Major
Sequence
MNSQQKEIKNKPHFQVITSDLALAEICYSAQQKAVIALDTEFVRIKTLYPQLGLIQLYDG
ERVSLIDPTTIQDFSPFIALLANTAVLKVLHACSEDLEVFQHSFNQLPTPMLDTQIMANF
LGFPNSTGLATLVQHYFQLEIDKGASRTDWLARPLSDNQLIYAAADVWYLLPLYQRMQEA
LAQTRWQEAAQQDCEALLLKREQHKDPELAYLGIPNAWRLTPSELMRLKLLAKWRQEEAT
KRDLALNFVVRAEHLWQVAKHNPKHTSELLALGLSHHEVRIHGKKILHLIGQLKRFDDVD
YPMPIVRIADDPRYKKALKGLQQKLKSIAPPDLAAEVIASKRGLENLMKWCWLDNQDPTQ
LPELLVGWRREFGLVLLNTLANG
Download sequence
Identical sequences Q9CMV0
272843.PM0706 WP_010906805.1.12311 WP_010906805.1.15732 WP_010906805.1.19996 WP_010906805.1.21657 WP_010906805.1.51342 WP_010906805.1.6219 WP_010906805.1.62389 WP_010906805.1.66990 WP_010906805.1.8281 WP_010906805.1.89773 WP_010906805.1.9947 gi|15602571|ref|NP_245643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]