SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010906996.1.81885 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010906996.1.81885
Domain Number 1 Region: 206-385
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 7.14e-47
Family Mannitol 2-dehydrogenase 0.0014
Further Details:      
 
Domain Number 2 Region: 1-204
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.24e-41
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010906996.1.81885
Sequence length 385
Comment mannitol-1-phosphate 5-dehydrogenase [Pasteurella multocida]; AA=GCF_002023905.1; RF=na; TAX=115545; STAX=747; NAME=Pasteurella multocida subsp. septica; strain=CIRMBP-0827; AL=Scaffold; RT=Major
Sequence
MKALHFGAGNIGRGFIGKLLADSGIQVIFADVNDHVIEQLKTQRAYPVKIVGDRLNVIET
VSNVTGVNSKNEADIIACFTEVDLVTTAVGPNVLKIISSTIAKGLSARFRAGNTRPLNII
ACENMVRGTSFLKDNVFSYLTPEEQQQAEAQIGFVDSAVDRIVPPVQFDPANPLLVTVEE
FSEWIVDKTQFKGTIPAITGMEQTDNLMAFVERKLFTLNTGHATTAYLGKLKGHQFVKDS
IDDPDIREAVKATMQESGAVLIKRYGFDPHAHAAYIEKILKRFANPYLQDDVDRVGREPL
RKLSYNDRLIKPLRGTLEYGLPNQHLIQTIASALAYRNESDPQAVELAQLLQQDTLESAV
KKITELTESNIVQQIVTAYNALQKN
Download sequence
Identical sequences Q9CLY7
gi|15602927|ref|NP_245999.1| 272843.PM1062 WP_010906996.1.12311 WP_010906996.1.15732 WP_010906996.1.19996 WP_010906996.1.62389 WP_010906996.1.66990 WP_010906996.1.81885 WP_010906996.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]