SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010917101.1.10044 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010917101.1.10044
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily Transposase IS200-like 1.31e-45
Family Transposase IS200-like 0.000000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010917101.1.10044
Sequence length 134
Comment IS200/IS605 family transposase ISTvo5 [Thermoplasma volcanium]; AA=GCF_000011185.1; RF=representative genome; TAX=273116; STAX=50339; NAME=Thermoplasma volcanium GSS1; strain=GSS1; AL=Complete Genome; RT=Major
Sequence
MELKSTRHVKYLCNYHYLWIPKYRRAILTNEVAEYTKEVLKSIAKELGCEIIALEVMPDH
IHLFVNCPPRYSPSYLTNYFKGKSARLILKKSPELRRYKKLWSRSYFVSTAGNVSSETIK
KYIEEQWVKEGEEG
Download sequence
Identical sequences Q97AF3
273116.TVN0843 gi|13541674|ref|NP_111362.1| WP_010917101.1.10044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]