SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010922862.1.8449 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010922862.1.8449
Domain Number 1 Region: 12-121
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000197
Family Middle operon regulator, Mor 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010922862.1.8449
Sequence length 152
Comment IS630 family transposase [Sulfolobus solfataricus]; AA=GCF_000007005.1; RF=na; TAX=273057; STAX=2287; NAME=Sulfolobus solfataricus P2; strain=P2; AL=Complete Genome; RT=Major
Sequence
MPKSRMHGIRLNKKQEEERRINAVKDVRNGMSIKDVAKKYDVSIFTVYKWLRKGDLSAKP
RKGPTKLKDEEKLVRILEKSPRDFGLNYDFWTLKLIAYILDKEFGIKYNPRSLSPVLKKL
GFKYKKGKRTYVRDDNAVERWVKEQGEKLLKK
Download sequence
Identical sequences A0A0E3JYL4 D0KNG8 Q97TX2
273057.SSO0040 273057.SSO1264 273057.SSO1750 273057.SSO2992 gi|15897010|ref|NP_341615.1| gi|15898107|ref|NP_342712.1| gi|15898551|ref|NP_343156.1| gi|15899703|ref|NP_344308.1| WP_010922862.1.8449 WP_010922862.1.93834 gi|384433510|ref|YP_005642868.1| gi|384434750|ref|YP_005644108.1| gi|384434812|ref|YP_005644170.1| gi|384434878|ref|YP_005644236.1| gi|384434922|ref|YP_005644280.1| gi|384435175|ref|YP_005644533.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]