SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010923242.1.8449 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010923242.1.8449
Domain Number 1 Region: 6-126
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000136
Family Cgl2762-like 0.045
Further Details:      
 
Domain Number 2 Region: 192-304
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000316
Family Retroviral integrase, catalytic domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010923242.1.8449
Sequence length 327
Comment IS630 family transposase [Sulfolobus solfataricus]; AA=GCF_000007005.1; RF=na; TAX=273057; STAX=2287; NAME=Sulfolobus solfataricus P2; strain=P2; AL=Complete Genome; RT=Major
Sequence
MQDLVQAYKEEKNARIKERILAVKLHVVDGKSEKEVSKMLNKGYSTIKLWIGKYKKEGLD
GLKDKPRSGRPRKVEEEKIKQILEDKPQKYGIQQEYWTMKTLKIALQEQGIEYKKSRLYE
LVHELGYNLVKPRPTNIQAEKDKWEDFKKIKKLERKALFFLDECRTVISTSIKKVLAKVG
SKPVMRVNIGFSSIYVILAINAWTGEVVVSLAKRPNSESVKYFLRYFKRRVGSGRVYMVM
DNYSPHKTKGTLEVCRRKGIHPVFTPPYSPELNMAEAVFKSLKNYMSNKIFYTIEDVKNC
IKQFFEENKYRFNLNAITYLGLDKIEV
Download sequence
Identical sequences A0A0E3MEZ4 D0KQB9 Q97TV5
353989 354060 273057.SSO1200 273057.SSO1238 gi|384433227|ref|YP_005642585.1| gi|384434637|ref|YP_005643995.1| gi|15898053|ref|NP_342658.1| gi|15898087|ref|NP_342692.1| WP_010923242.1.14611 WP_010923242.1.22626 WP_010923242.1.43719 WP_010923242.1.66040 WP_010923242.1.8449 WP_010923242.1.93834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]