SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010923679.1.8449 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010923679.1.8449
Domain Number 1 Region: 6-126
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000161
Family Cgl2762-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010923679.1.8449
Sequence length 150
Comment IS630 family transposase [Sulfolobus solfataricus]; AA=GCF_000007005.1; RF=na; TAX=273057; STAX=2287; NAME=Sulfolobus solfataricus P2; strain=P2; AL=Complete Genome; RT=Major
Sequence
MQDLVQAYKEEKNARIKERILAVKLHVVDGKSEKEVSKMLNKGYSTIKLWIGKYKKEGLD
GLKDKPRSGRPRKVEEEKIKQILEDKPQKYGIQQEYWTMKTLKIALQEQGIEYKKSRLYE
LVHELGYNLVKPRPTNIQAEKDKWEDFKKK
Download sequence
Identical sequences A0A157T2E4 Q97TW2
273057.SSO1719 273057.SSO2927 273057.SSO2949 WP_010923679.1.8449 gi|15898526|ref|NP_343131.1| gi|15899638|ref|NP_344243.1| gi|15899656|ref|NP_344261.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]