SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010923718.1.8449 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010923718.1.8449
Domain Number 1 Region: 12-123
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000134
Family Cgl2762-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010923718.1.8449
Sequence length 157
Comment IS630 family transposase [Sulfolobus solfataricus]; AA=GCF_000007005.1; RF=na; TAX=273057; STAX=2287; NAME=Sulfolobus solfataricus P2; strain=P2; AL=Complete Genome; RT=Major
Sequence
MVQAYEEEKDARIKERILSVKLHLVDGKSEKKVSKMLNKGYSTIKLWVGKYKKEGLNGLR
DKPRSGRPRKAEKGKIKQILEDQPQKYGIQEEYWTMRTFKIALQEQGIEYKKSRLYELVH
ELGYNLVKPRPTNVQAKKDMWDDFKIGRRGSLLSRRE
Download sequence
Identical sequences A0A157T4A0 Q97WV6
gi|15898799|ref|NP_343404.1| 273057.SSO2006 WP_010923718.1.8449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]