SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010927064.1.69310 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010927064.1.69310
Domain Number 1 Region: 96-227
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.88e-26
Family GntR ligand-binding domain-like 0.0067
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000133
Family GntR-like transcriptional regulators 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010927064.1.69310
Sequence length 236
Comment MULTISPECIES: GntR family transcriptional regulator [Bordetella]; AA=GCF_000662115.1; RF=na; TAX=1458256; STAX=518; NAME=Bordetella bronchiseptica 980; strain=980; AL=Contig; RT=Major
Sequence
MSSTKRPASRADEITQELVRMIQLADARRIAKLPTEMELAAQLGISRPVIRESLSRLESL
NMVTRRQGSGLYIVAPEKRSPEALVLLEQSAPLSPRSIAEAMSVRAILELETGRLAALNH
RQVDLDRMAAEIERLAATGARGLEAAEADEAFHRALSDAAGNVTLSQVLDLFLRLSWRRR
VEYFSQPKLGKQSIIEHQEILNAVASGDPDAVSTAIRTHLNSAERFWDSKYVKKKS
Download sequence
Identical sequences A0A0C6PDC8 A0A0H3LQE9 A0A2J9U670 K0M8D7 Q7W4E8
gi|33603139|ref|NP_890699.1| APC88999 WP_010927064.1.14246 WP_010927064.1.15674 WP_010927064.1.1660 WP_010927064.1.20111 WP_010927064.1.21837 WP_010927064.1.23657 WP_010927064.1.26498 WP_010927064.1.29688 WP_010927064.1.30681 WP_010927064.1.40806 WP_010927064.1.54628 WP_010927064.1.57255 WP_010927064.1.58338 WP_010927064.1.69310 WP_010927064.1.71104 WP_010927064.1.71382 WP_010927064.1.71489 WP_010927064.1.72199 WP_010927064.1.82663 WP_010927064.1.84958 WP_010927064.1.86585 WP_010927064.1.88542 WP_010927064.1.93987 YP_006894974.1.34978 YP_006970286.1.84680 gi|410471693|ref|YP_006894974.1| gi|33598228|ref|NP_885871.1| gi|412341531|ref|YP_006970286.1| 257310.BB4164 257311.BPP3718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]