SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010927986.1.26498 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010927986.1.26498
Domain Number 1 Region: 450-554
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.55e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010927986.1.26498
Sequence length 563
Comment sodium-independent anion transporter [Bordetella parapertussis]; AA=GCF_000195695.1; RF=na; TAX=257311; STAX=519; NAME=Bordetella parapertussis 12822; strain=12822; AL=Complete Genome; RT=Major
Sequence
MPHSVACLDLRVIALLEAKRAGLLRRAHWLPNIVSGLIVGVVALPLAMAFAIASGAKPEQ
GLYTAIVAGLLVSLCGGSRVQIAGPTGAFIVILAGITAQHGVAGLQLATLMAGCILLALG
AARLGAIIKYIPAPVIVGFTAGIGVIIWVGQWKDFFGLPSPAGTHFHEKLWQLVHSLPQL
HLATTALAALSLALLLLNNRLPYLRRVPGPLVALVVATTLQAVLGLDGVATIGSAFGGIP
QGLPSWQWPEITVSRVIELIGPAFAIAMLGAIESLLSAVVADGMAGTRHDSNQELVGQGL
ANIVAPLFGGFAATGAIARTATSIRNGGTSPLAGVVHCITLLLMVLLLAPLAENVPLAAL
AAILFVVAWNMSDAPHFVRMIKRAPRADVAILLVTFVLTVFADLVVAVNIGVVIAILHFL
RRMASSVQVQAQSPAELGDELGHRGYGPLPDDVLVYAVEGPLFFGAAENFERALAATHTD
PRTLIIRLRWVPFIDITGLQALEEVITDLQRRGVRVILSGANPRVKAKLHRAGLVGLAGA
DNVFDRFEDAVLSCRAPAAPATA
Download sequence
Identical sequences A0A2J9U0Z0 Q7WAN8
WP_010927986.1.23657 WP_010927986.1.26498 GO.9075 257311.BPP1336 gi|33595996|ref|NP_883639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]