SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010951785.1.87606 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010951785.1.87606
Domain Number 1 Region: 80-405
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.36e-47
Family Cystathionine synthase-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010951785.1.87606
Sequence length 475
Comment MULTISPECIES: L-selenocysteinyl-tRNA(Sec) synthase [Pseudomonas]; AA=GCF_001320165.1; RF=na; TAX=1661036; STAX=1661036; NAME=Pseudomonas sp. NBRC 111121; strain=NBRC 111121; AL=Contig; RT=Major
Sequence
MSNSLASDTPRLPSIDTLLRHPACLPLIDRHGRDAVLNTLRQLLDDLREPARNGELGSAE
LAPEILLGRSGERLALQQRSQVRRVFNLTGTVLHTNLGRALLPDEAIEAMQTAARYPLNL
EFDLATGKRGDRDDLIEGLIRELTGAEAVTVVNNNAAAVLLALNSLGARKEGIISRGELI
EIGGAFRIPDIMARAGVKLHEVGTTNRTHARDYEAAIGPRTGLLMRVHCSNYSIQGFTTQ
VPTAELARIAHQHELPLLEDLGSGSLLDLTRWGLPAEPTVRQALADGADIVTFSGDKLLG
GPQAGIIVGHKDLITRIKKNPLKRALRVDKITLAALEAVLALYRNPDRLAERLPSLRLLT
RSQAEIQAQAERLAPELQARLGEQWAISVEPALGMIGSGSQPVARLPSAALCLRPQVSKK
LRGRSLHVLERALRDLPVPVLGRIDDDALWLDLRQLDDEAQWLAQLPALQLGPVQ
Download sequence
Identical sequences Q88QJ8
gi|26987233|ref|NP_742658.1| 160488.PP_0493 NP_742658.1.35174 WP_010951785.1.28295 WP_010951785.1.28475 WP_010951785.1.3142 WP_010951785.1.58218 WP_010951785.1.71439 WP_010951785.1.87606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]