SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010951840.1.28295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010951840.1.28295
Domain Number 1 Region: 75-352
Classification Level Classification E-value
Superfamily PLP-binding barrel 7.85e-67
Family Alanine racemase-like, N-terminal domain 0.00088
Further Details:      
 
Domain Number 2 Region: 458-570
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.000000663
Family Eukaryotic ODC-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010951840.1.28295
Sequence length 637
Comment MULTISPECIES: arginine decarboxylase [Pseudomonas]; AA=GCF_001753855.1; RF=na; TAX=1661060; STAX=1661060; NAME=Pseudomonas sp. GTC 16473; strain=GTC 16473; AL=Contig; RT=Major
Sequence
MSVRRTRKDDGSQWTVADSRSVYGIRHWGAGYFAINEAGRVEVRPNGPQSAPIDLFEQVD
ELRQSGLSLPLLVRFPDILQDRVRQLTGAFDANIARLEYQSQYTALYPIKVNQQEAVVEN
IIATQNVSIGLEAGSKPELLAVLALAPKGGTIVCNGYKDREFIRLALMGQKLGHNVFIVI
EKESEVALVIEEAAELKVKPQVGLRVRLSSLASSKWADTGGEKSKFGLSAAQLLSVVQRF
RDAGLDQGIRLLHFHMGSQIANLADYQHGFKEAIRYYGELRALGLPVDHIDVGGGLGVDY
DGTHSRNASSINYDMDDYAGVVVGMLKEFCDAQGLPHPHIFSESGRSLTAHHAMLVIQVT
DVEKHNDDVPTIENKEALPETVQWLVDLLGPTDIEMVTETYWRATHYMGDVAAQYADGKL
SLGEKALAEQCYFAVCRRLHNSLKARQRSHRQVLDELNDKLADKYICNFSVFQSLPDTWA
IGQVLPIIPLHRLDEEPMRRAVLQDLTCDSDGKINQYVDEQSIETSMPVHAVKEGEDYLL
GVFLVGAYQEILGDMHNLFGDTDSVNIYQNADGSVYHAGIETHDTIEDMLRYVHLSPEEL
MTHYRDKVASAKITARERTQYLDALRLGLTRSSYLSS
Download sequence
Identical sequences A0A0A7PXZ5 A0A179QY44 Q88QC7
PpR183 160488.PP_0567 gi|386010235|ref|YP_005928512.1| NP_742730.1.35174 WP_010951840.1.28295 WP_010951840.1.28475 WP_010951840.1.3142 WP_010951840.1.31851 WP_010951840.1.34900 WP_010951840.1.41 WP_010951840.1.42045 WP_010951840.1.47320 WP_010951840.1.48025 WP_010951840.1.58218 WP_010951840.1.62773 WP_010951840.1.675 WP_010951840.1.71439 WP_010951840.1.73516 WP_010951840.1.87606 gi|26987305|ref|NP_742730.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]