SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010953790.1.87606 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010953790.1.87606
Domain Number 1 Region: 3-174
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 9.42e-32
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010953790.1.87606
Sequence length 177
Comment MULTISPECIES: cytochrome b [Pseudomonas]; AA=GCF_001320165.1; RF=na; TAX=1661036; STAX=1661036; NAME=Pseudomonas sp. NBRC 111121; strain=NBRC 111121; AL=Contig; RT=Major
Sequence
MKPQAFHPFARLLHWLMAVLILAMLFIGVSMVPDLSLRHPVLISLHKATGLALLVLVVLR
IAVRLTLPHPPLPNDLPKLQRWAAGASHLLLYGLMLAMPLLGWAMLSAGDYPRPLGLPAI
APHNLQLYAVLRQAHGWAGYLLFATVLVHVGAALMHAWVRRDGVLRSMWPGPLHRSE
Download sequence
Identical sequences Q88IW3
GO.819 GO.8579 gi|26989605|ref|NP_745030.1| NP_745030.1.35174 WP_010953790.1.28295 WP_010953790.1.28475 WP_010953790.1.3142 WP_010953790.1.58218 WP_010953790.1.71439 WP_010953790.1.87606 160488.PP_2886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]