SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010961086.1.29143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010961086.1.29143
Domain Number 1 Region: 130-351
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.21e-69
Family SCOPe 0.0000000278
Further Details:      
 
Domain Number 2 Region: 1-124
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.25e-34
Family SCOPe 0.00000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010961086.1.29143
Sequence length 356
Comment dipeptide epimerase [Methylococcus capsulatus]; AA=GCF_000008325.1; RF=representative genome; TAX=243233; STAX=414; NAME=Methylococcus capsulatus str. Bath; strain=Bath; AL=Complete Genome; RT=Major
Sequence
MKIADIQVRTEHFPLTRPYRIAFRSIEEIDNLIVEIRTADGLLGLGAASPERHVTGETLE
ACHAALDHDRLGWLMGRDIRTLPRLCRELAERLPAAPAARAALDMALHDLVAQCLGLPLV
EILGRAHDSLPTSVTIGIKPVEETLAEAREHLALGFRVLKVKLCGDEEQDFERLRRLHET
LAGRAVVRVDPNQSYDRDGLLRLDRLVQELGIEFIEQPFPAGRTDWLRALPKAIRRRIAA
DESLLGPADAFALAAPPAACGIFNIKLMKCGGLAPARRIATIAETAGIDLMWGCMDESRI
SIAAALHAALACPATRYLDLDGSFDLARDVAEGGFILEDGRLRVTERPGLGLVYPD
Download sequence
Identical sequences Q607C7
WP_010961086.1.29143 3rit_A 3rit_B 3rit_C 3rit_D 3rit_E 3ro6_A 3ro6_B 3ro6_C 3ro6_D 3ro6_E 3ro6_F NYSGXRC-9454d gi|53803900|ref|YP_114271.1| 243233.MCA1834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]