SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010978080.1.60790 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010978080.1.60790
Domain Number 1 Region: 49-130
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000278
Family Cgl2762-like 0.044
Further Details:      
 
Weak hits

Sequence:  WP_010978080.1.60790
Domain Number - Region: 158-231
Classification Level Classification E-value
Superfamily CorA soluble domain-like 0.0144
Family CorA soluble domain-like 0.046
Further Details:      
 
Domain Number - Region: 8-46
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0179
Family Transcriptional factor domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010978080.1.60790
Sequence length 242
Comment insertion element protein [Sulfolobus tokodaii]; AA=GCF_000011205.1; RF=representative genome; TAX=273063; STAX=111955; NAME=Sulfolobus tokodaii str. 7; strain=7; AL=Complete Genome; RT=Major
Sequence
MGRKPVIRHDIACPSCGSHHVVKCGKPLGRQRFLCRDCGKYFLADAVYHHHSKEVREKAL
RMYTNGMSMRAISRVLNVPLGTVFTWVKRYGKRKYEKLVDLWNKAKELVKGKVVTKVVDE
MWTYLYRNTRAFYKWVFNCYVYTRLGFYLVYSVGDRDENTFREVKDYVPDDGRWVSDDYN
VYFWLKNHTVVSPVNPNESFHSSLRDRLVKRATKAVNRSINMVKYSIALVLWERRLIPEF
VA
Download sequence
Identical sequences Q976P8
273063.ST0142 gi|15920320|ref|NP_375989.1| WP_010978080.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]