SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010982533.1.30226 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010982533.1.30226
Domain Number 1 Region: 13-122
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.2e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010982533.1.30226
Sequence length 139
Comment anti-anti-sigma factor [Streptomyces avermitilis]; AA=GCF_002017835.1; RF=na; TAX=33903; STAX=33903; NAME=Streptomyces avermitilis; strain=MJM 7007; AL=Contig; RT=Major
Sequence
MIGDPLGRPGIHVPVLKLGNVLLVTLQGDLHDHAAEQLQQDIGEAVASSAVTGVVIDVSG
VEIVDSFLGRVFAEIAATARLLAAQTIVAGMRPAVAITLVELGLTLPGLRTALDAEQAMR
LLTGTPPHLPHVPGRRESA
Download sequence
Identical sequences Q82P38
gi|29827636|ref|NP_822270.1| WP_010982533.1.19017 WP_010982533.1.30226 WP_010982533.1.49792 WP_010982533.1.60620 WP_010982533.1.68722 227882.SAV_1095 APC65480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]