SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010984107.1.60620 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010984107.1.60620
Domain Number 1 Region: 8-225
Classification Level Classification E-value
Superfamily DhaL-like 2.22e-26
Family DhaL-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010984107.1.60620
Sequence length 571
Comment dihydroxyacetone kinase [Streptomyces avermitilis]; AA=GCF_000764715.1; RF=na; TAX=227882; STAX=33903; NAME=Streptomyces avermitilis MA-4680 = NBRC 14893; strain=NBRC 14893; AL=Scaffold; RT=Major
Sequence
MPQVPQTFDALAVRTWCGLALQALGRARAEIDAINVYPVADGDTGTNLYLTVESAATAVE
AVFAGHDAMGAVGGTSDAASAGPGRPTLADAVQAMAHGALIGARGNSGTILAQLLRGMAQ
VLAADSETAHTDGQGLRLALRHAADSAREAVAHPVEGTVLTVASAAADAATGAEDGCGSV
ARAAYEGACAALAATPGQLAVLRRAGVVDAGGRGLVAVLAALVQTFTGEAPGASGAVVHA
RVDDEAAAGRPDAGECGDGPPAEGGPAFEVIYLLEADDAAVGRLRSRLDGLGESLVVVGG
DGLWNVHVHVDDAGAAVEAGVEAGRPYRIRITHFAAGDVHTGGAGRPPREPAQRAVVAVV
PGEGLAGLYAEAGATTVLARAGEPPVSGELVDAVRRAHAREVVLLPNDAELRHTAAAAAE
QARTEGVRVALIPTRSAVQGIAALAVHEPERRFDEDVVAMTSAAGATRYAEVAVAERQSW
TMAGICQAGDVLGLIEDDVAVIGSDVTETAEIILDRMLAAGGEMVTLVLGDEAPESIAAH
LESRVRESYLAVDTVVYRGGRQGPLLLIGVE
Download sequence
Identical sequences Q82JT0
WP_010984107.1.19017 WP_010984107.1.30226 WP_010984107.1.49792 WP_010984107.1.60620 WP_010984107.1.68722 227882.SAV_2674 gi|29829216|ref|NP_823850.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]