SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010993775.1.37988 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010993775.1.37988
Domain Number 1 Region: 239-496
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.94e-54
Family Pyruvate oxidase and decarboxylase Pyr module 0.045
Further Details:      
 
Domain Number 2 Region: 15-227
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.66e-16
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.024
Further Details:      
 
Domain Number 3 Region: 507-615
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.42e-16
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010993775.1.37988
Sequence length 616
Comment MULTISPECIES: MFS transporter [Bacteroides]; AA=GCF_001997325.1; RF=na; TAX=817; STAX=817; NAME=Bacteroides fragilis; strain=ATCC 25285; AL=Scaffold; RT=Major
Sequence
MADEMMVKELEEVVVRFSGDSGDGMQLAGNIFSNVSATVGNDICTFPDYPADIRAPQGSL
TGVSGFQVHVGASKIFTPGDHCHVLVAMNPAALKTQIKFCKPQGLVITDSDSFGEKDLEK
AQFKTGNPFEEMGITQQVLEVPISSMCKESLKNSGLDNKAMLRCKNMFALGLVCWLFNRN
LSAAEKMLNEKFAKKPEIAAANIKVLNDGYNYGANTHASTSTYKIESKTPKAAGLYTDIN
GNKATSYGLIAAAEKAGLELYLGSYPITPATDILHELAKHKSLGVKTVQCEDEIAGCASA
VGAAFAGDLAVTTTSGPGVCLKSEAMNLAVIAELPLVVVNVQRGGPSTGMPTKSEQTDLL
QALYGRNGESPMPVIAATSPTNCFDAAYMAAKIALEHMTPVVLLTDAFIANGSAAWKLPN
MDEYPAINPPYVTPDMIGTWTPFQRNEKTGVRYWAVPGTEGFMHRIGGLEKSSETGVIST
EPENHQKMTLLRQAKVDKIADSIPEQEVQGDADADLLVVGWGGTYGHLYSAVEHMRKNGK
KVALAHFQYINPLPKNTAEILKKYKKIVVAEQNLGQFAGYLRMKVPGLNISQFNQVKGQP
FVTRELVEAFTKLLEE
Download sequence
Identical sequences A0A139SYS8 A0A149MU81 Q5L7P0
APC66685.0 272559.BF4239 WP_010993775.1.37988 WP_010993775.1.58084 WP_010993775.1.6251 WP_010993775.1.95750 gi|60683657|ref|YP_213801.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]