SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010995694.1.33676 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010995694.1.33676
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily RbcX-like 9.81e-44
Family RbcX-like 0.00000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010995694.1.33676
Sequence length 132
Comment hypothetical protein [Nostoc sp. PCC 7120]; AA=GCF_000009705.1; RF=na; TAX=103690; STAX=103690; NAME=Nostoc sp. PCC 7120; AL=Complete Genome; RT=Major
Sequence
MNLKQIAKDTAKTLQSYLTYQALMTVLAQLGETNPPLALWLHTFSVGKVQDGEAYVKELF
REQPDLALRIMTVREHIAEEVAEFLPEMVRSGIQQANMEQRRQHLERMTHLSLSNPSPES
EQQTISDTDWDH
Download sequence
Identical sequences A0A1W5CLZ2 A0A1Z4KTZ8 O86418 Q3M675 Q798D4
WP_010995694.1.33676 gi|75910110|ref|YP_324406.1| 2005405532 103690.alr1525 240292.Ava_3906 gi|17229017|ref|NP_485565.1| 359436 NsR16

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]