SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011011139.1.13913 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011011139.1.13913
Domain Number 1 Region: 1-182
Classification Level Classification E-value
Superfamily LigT-like 4.19e-45
Family 2'-5' RNA ligase LigT 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011011139.1.13913
Sequence length 184
Comment RNA 2',3'-cyclic phosphodiesterase [Pyrococcus furiosus]; AA=GCF_000275605.1; RF=na; TAX=1185654; STAX=2261; NAME=Pyrococcus furiosus COM1; strain=COM1; AL=Complete Genome; RT=Major
Sequence
MRAFIAIDVSESVRDALVRAQDYIGSKEAKIKFVERENFHITLKFLGEITEEQAEEIKKI
LEKIAKKYKKHEVNVRGIGVFPNPNYVRVIWAGVENDEIIKKIAKEIDDELAKLGFKKEG
NFVAHITLGRVKFVKDKLGLAMKLKELANEDFGSFIVEAIELKKSTLTPKGPIYETLARF
ELSE
Download sequence
Identical sequences I6U8X2 Q8U4Q3
gi|18976399|ref|NP_577756.1| gi|397652258|ref|YP_006492839.1| d2fyha1 WP_011011139.1.13913 WP_011011139.1.59273 186497.PF0027 Pfu-34545-001 ar_001000706.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]