SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011012191.1.59273 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011012191.1.59273
Domain Number 1 Region: 157-274
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.56e-32
Family Homoserine kinase 0.0032
Further Details:      
 
Domain Number 2 Region: 1-149
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-29
Family GHMP Kinase, N-terminal domain 0.0000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011012191.1.59273
Sequence length 292
Comment homoserine kinase [Pyrococcus furiosus]; AA=GCF_000007305.1; RF=representative genome; TAX=186497; STAX=2261; NAME=Pyrococcus furiosus DSM 3638; strain=DSM 3638; AL=Complete Genome; RT=Major
Sequence
MKVYAPATIANFGPGFDVFGLAIETPRDTVIAKESDDFRIEVEGYKVPENDENVALVAAK
ALFKLVGEEGGIYLKLKKGIRPKSGLGSSGASSIAGAVAAARILGVEDDEIIIRAALEGE
RKASGSPHGDNVVPSYYGNFTIVESLNPLRVHNIEVDFKVVVILPSVEVPTSEARKVLPK
KVPLKDAVKNIALASSLVLALKEGNLEEVGRLLEDHLALPYRLSLVPWFPKVKEAAKEAG
AYGVMISGSGPAVFALGENLKEIGKAMKEAFESFGIEAEYWVTKVGRGAKWC
Download sequence
Identical sequences I6UYV8 Q8U1Z9
gi|397651561|ref|YP_006492142.1| gi|18977426|ref|NP_578783.1| 186497.PF1054 Pfu-1009080-001 WP_011012191.1.13913 WP_011012191.1.59273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]