SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011015537.1.21641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011015537.1.21641
Domain Number 1 Region: 299-320,359-594
Classification Level Classification E-value
Superfamily HAD-like 1.65e-52
Family Meta-cation ATPase, catalytic domain P 0.00052
Further Details:      
 
Domain Number 2 Region: 112-209
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 6.54e-28
Family Calcium ATPase, transduction domain A 0.0024
Further Details:      
 
Domain Number 3 Region: 61-113,210-295
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000000222
Family Calcium ATPase, transmembrane domain M 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011015537.1.21641
Sequence length 625
Comment copper-translocating P-type ATPase [Corynebacterium glutamicum]; AA=GCF_000196335.1; RF=na; TAX=196627; STAX=1718; NAME=Corynebacterium glutamicum ATCC 13032; strain=DSM 20300 = ATCC 13032; AL=Complete Genome; RT=Major
Sequence
MKTWKTWGIVAVSGLLIILSWLTPAGWLSDGFMIAAAVVAGWQIALSAVQALRIRMISID
LLVIVAAIGALFINNYWESAAVTFLFALGKALEKATMNRTRKALSDLVDAAPETATVLRD
GEPETVEIWELAPGDVVLVKNGEQIPVDGRVLSGHGGVDEATITGESVPAEKAADSEVFA
GTWLRSGVLRIEAIGIGSDSTLAKIIHRVEDAQDDKAKTQTFLEKFSKYYTPGVMIAALA
VGLITLNVELALTLLVIACPGALVISIPVSIVAGIGRSAKDGVLIKGGEYLETSAKVDTV
VVDKTGTLTNGRPELTNVDVLDPAYSDDEVLTLAARAETASEHPLAEAIIRGAENRGLTV
AMVEKAEPVAGRGIRADVDGATVAVGSADLLDHTPDNTRILELNEQGRTAMYVGINGKAV
GIVAVADTIRDDAPAAIRSLHNKGIRVVMATGDAERVARNVAAELGVDEVRAELMPEDKL
EIVKELQAQGRVVAMVGDGVNDTPALATADIGVAMGAAGSPAAIETADIALMADKLPRLP
YALGLAQRTVRTMRVNIGIALLTVTILLAGVLLGGVTMSIGMLVHEASVLLVIAIAMLLL
RPTLKEDKDKADVSTADAAKETLSA
Download sequence
Identical sequences A0A286MAX4 Q8NLG8
gi|62391819|ref|YP_227221.1| NP_602166.1.3765 WP_011015537.1.21641 WP_011015537.1.3871 WP_011015537.1.80527 196627.cg3295 NYSGXRC-22053b gi|62391819|ref|YP_227221.1| gi|530316842|ref|YP_008402806.1| gi|62391819|ref|YP_227221.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]