SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011024165.1.98848 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011024165.1.98848
Domain Number 1 Region: 17-340,399-440
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.2e-49
Family Quinoprotein alcohol dehydrogenase-like 0.0012
Further Details:      
 
Domain Number 2 Region: 694-962
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.12e-37
Family Quinoprotein alcohol dehydrogenase-like 0.0039
Further Details:      
 
Domain Number 3 Region: 1172-1257
Classification Level Classification E-value
Superfamily PKD domain 1.23e-29
Family PKD domain 0.00023
Further Details:      
 
Domain Number 4 Region: 604-689
Classification Level Classification E-value
Superfamily PKD domain 2.75e-28
Family PKD domain 0.00021
Further Details:      
 
Domain Number 5 Region: 514-598
Classification Level Classification E-value
Superfamily PKD domain 7.59e-28
Family PKD domain 0.00031
Further Details:      
 
Domain Number 6 Region: 421-509
Classification Level Classification E-value
Superfamily PKD domain 5.76e-25
Family PKD domain 0.00041
Further Details:      
 
Domain Number 7 Region: 1077-1166
Classification Level Classification E-value
Superfamily PKD domain 3.01e-24
Family PKD domain 0.00029
Further Details:      
 
Domain Number 8 Region: 962-1077
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.14e-19
Family Quinoprotein alcohol dehydrogenase-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011024165.1.98848
Sequence length 1386
Comment cell surface protein [Methanosarcina acetivorans]; AA=GCF_000007345.1; RF=representative genome; TAX=188937; STAX=2214; NAME=Methanosarcina acetivorans C2A; strain=C2A; AL=Complete Genome; RT=Major
Sequence
MKIFLICLTLLLVTAAQPVLGSDWAQFQRDVYNTGVTADRAPITDPMNSTLSWEYKLGAN
VDSAPIVAGDMMYALVGNNHIYAFNRITGELVWEESTSGSLGFLIGNAAVGNGIVFVPTT
NGQIFAFDAETGDLKWNKTVSSKQLDTPIVYSDGKIYFGEAMGGRNYYCLDEDGNEVWSR
TATTQESSQGSYYWAGAAVIGNNLVYGDNDGYIVSVNKDTGTDIAEINVSEEFGVDCKEI
RSSILYVEDLGRVYFTSTGGYCFALGFNPADGTFKTSDKHSANIAYASTTTPAYYNGRVY
IGSGEIMKANGNGVYCLDADLTGVIWNYPVGGTGIVQSSPALSTYYDDGDGEVYIYFTVN
AKPIGGVYCLKDLPDSTSPELVWSYVESGKTDFSLPGVAISDGWVYYGTDNKYIFGLTTP
DSQVPEAPTADFSATPVSGDAPLTVSFADLSTGDGITTWAWDFENDGNVDSTEQNPSYTY
SDAGTYTVSLTVTGEGGSDSEEKADYISVSESSAPVEPVAAFAADVTSGTAPLTVNFTDQ
STGSPIAWAWDFDNDGNVDSSEQNPSYTYSDAGSYTVNLTVTNEAGSNSAVETDYITVSE
SSTPTEPEPVAAFAADVTSGTAPLTVNFTDQSTGSPTSWEWDFDNDGNVDSTEQNPSYTY
SDAGIYTVKLTVSNENGSDVLEILEMITVKETVVSEDAWYQFHKDAQHSGYSSSDAPDSA
NLAWIAEPLNDTYSLVPSSSVVIAEGMVFGLCNGPVDEYGNPLTSEGQLVAFDEETGEEI
WNVTVMAPEWGSWSCPAYDDGKVFASAGKNTYCVNASTGDIIWTFQNPSELASCNGGPSI
GDGKVFASDWDGGNYYCLDENTGELLWTFKIDGLYAQSTPAYKDDRVYLSGWTTVNAVYC
VNATTGELIWENEELSSNPCGSITVTEEGLYLSIYSFGTEDGFYKLDLTDGHEIWGRPDI
PPTDSTPAVVNGKVYLSAGTAGYSDLNTYCLNASDGKTIWVTDSSENIGDWVCSPAVADG
KVFTGGAAEGLFTGSSTLYAFDAETGAVVWSYKGCGGSPAVADDMVFSTGSGKLYAFKEA
EVLLPEAKFSSNVSSGEAPLTVGFTDESTGEGITAWEWDFDNDGTVDSTEQNPIHTYDNA
GSYTVNLTVTSAEGIDSEVKMDYINVSESSTPGEPEPVAAFIANVTSGTAPLTVNFTDQS
TGSPTSWEWDFDNDGNVDSTEQNPSYTYSDAGSYTVNLTVTNAEGSNSEVKTEYITVEEA
SSGSQNGSSSVSLNVTIVPVISLEVSPSALDFGELYPGKTSELQYLTLKNRGSCDINVTA
VVCDCSAEDELFSQGLLLDSQLWNNYWKVVGKNSQENTSVALQVPADYAGSGNKKGTITF
WAEAAE
Download sequence
Identical sequences Q8TI72
WP_011024165.1.98848 188937.MA4284 gi|20093073|ref|NP_619148.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]