SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011024182.1.98848 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011024182.1.98848
Domain Number 1 Region: 814-1060
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.23e-37
Family Quinoprotein alcohol dehydrogenase-like 0.0047
Further Details:      
 
Domain Number 2 Region: 121-434
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.88e-33
Family Quinoprotein alcohol dehydrogenase-like 0.0046
Further Details:      
 
Domain Number 3 Region: 1059-1142
Classification Level Classification E-value
Superfamily PKD domain 2.49e-26
Family PKD domain 0.00024
Further Details:      
 
Domain Number 4 Region: 23-105
Classification Level Classification E-value
Superfamily PKD domain 3.79e-23
Family PKD domain 0.00029
Further Details:      
 
Domain Number 5 Region: 524-606
Classification Level Classification E-value
Superfamily PKD domain 5.62e-22
Family PKD domain 0.00066
Further Details:      
 
Domain Number 6 Region: 610-695
Classification Level Classification E-value
Superfamily PKD domain 8.37e-20
Family PKD domain 0.00072
Further Details:      
 
Domain Number 7 Region: 698-805
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000314
Family Quinoprotein alcohol dehydrogenase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011024182.1.98848
Sequence length 1271
Comment cell surface protein [Methanosarcina acetivorans]; AA=GCF_000007345.1; RF=representative genome; TAX=188937; STAX=2214; NAME=Methanosarcina acetivorans C2A; strain=C2A; AL=Complete Genome; RT=Major
Sequence
MAITPASATTSDWLLDGGSSGGEVTPVANFSAEVISGTVPLTVNFTDESTGAESWAWDLD
GDGILDSTEQNPVHTYTTAGEYSVNLTVTSFNSSDSEIKTGYITVMADGSSGGESGETPV
AVAPVPDSSDTAMFKNNLYHTGVTSQAGPIDDPDLVWSAHTGYMNTDPLVLDDLLVSVCS
HNISVHNRTTGEYIWNTVTSGENLGPACYGNGKIFYPESSRGKLSAYDIRNGELLWNITG
LGGSYSQLNTPVVYEDHRIYFGTCYGNPSAYYCYYDNGTQCWSYEGGGYYWAGAAVIGDY
LVFGGEDMNLTSLNKNTGELVDEINVSAVFSIPNSGSQIQSSVSYDENSSRCYFTTTSGS
CCVIGFDKSTGKFVRTDKASHSIGPSTSTPAIYNGRLYVGVGKMFKSGGEPCLFCLNASD
LSEIWKYTANGIIQSSPTVSTYYENSTGDIYIYFTTNVKNGTVYCLRDNASNTDAMEVWH
WTPPESMQQYVLGGAVIKQGYLFFGNNEWKGVAGCTFALKRSDFGPVVADFSAENTFGKA
PLNVSFTDESTGYGINEWLWDFGDNTTSNETNPYHIYEKNGLYTVSLTVTGSGESNTSTR
TGLVNVTDQITPVADFSYSVSGTQSPVSVEFTDTSDNINSATTWSWDFGDNTTSNLQNPT
HQYAEEGTYSVTFTVSSQYENNTVKKSGIIVVEPWNVPEWATNDSWPQFQKDAQHSGFSE
GSAPSTATRLWVSDDIGAVRSSSVAVAGGRIFVNCNDNDTGISVIRSLSQQTGAILADHG
KADGGGFYGSWSSPVYDDGKVWCGLNNYPEGTTYNSVNGGTMVADGKVFSSNWNGNQYFC
FEESTGEELWNFSAPVSSYAQSCPAYKDGKIYVLYWHGFSGDGENLVYCLNASTGEAIWK
HANISSNPCGSPMISDDAVYFTTYNPEGESAQLYALSITDGSVLWSNTSITGTDSTPAYA
YGNIYVSSGYSRYITYCFNATTGEPVWETDPEDNIGFWTCSPAVADGKVYVGTGGSGIVC
LDASTGELIWQDEGGGSTPAIVDGVVYSVGKDGKVYAYSSSQSVADFTANPISGEAPLTV
NFTDQSNGAESWAWDFDSDGNVDSTEQNPVHTYTAAGNYTVNLTVTNAEGSDSEVKTEYI
TVEEASSGSQNGSSSVSLNVTIVPVISLEVSPSALEFGELYPGKTSELQYLTLKNRGSCD
VNVTAVVCDSSAGDELFSQGLLLDSQLWNNYWKVVGGNSQENTSVALQVPADYAGSGNKK
GTITFWAEAAK
Download sequence
Identical sequences Q8TI55
WP_011024182.1.98848 gi|20093090|ref|NP_619165.1| 188937.MA4301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]