SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011024190.1.98848 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011024190.1.98848
Domain Number 1 Region: 602-964
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 8.03e-50
Family Quinoprotein alcohol dehydrogenase-like 0.006
Further Details:      
 
Domain Number 2 Region: 968-1049
Classification Level Classification E-value
Superfamily PKD domain 1.19e-30
Family PKD domain 0.00021
Further Details:      
 
Domain Number 3 Region: 12-328
Classification Level Classification E-value
Superfamily Pectin lyase-like 9.43e-30
Family Pectin methylesterase 0.033
Further Details:      
 
Domain Number 4 Region: 336-421
Classification Level Classification E-value
Superfamily PKD domain 2.09e-25
Family PKD domain 0.00039
Further Details:      
 
Domain Number 5 Region: 425-508
Classification Level Classification E-value
Superfamily PKD domain 4.05e-24
Family PKD domain 0.0003
Further Details:      
 
Domain Number 6 Region: 512-597
Classification Level Classification E-value
Superfamily PKD domain 4.05e-22
Family PKD domain 0.00034
Further Details:      
 
Weak hits

Sequence:  WP_011024190.1.98848
Domain Number - Region: 1208-1261
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00155
Family Type I dockerin domain 0.012
Further Details:      
 
Domain Number - Region: 1065-1187
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.00314
Family Cellulose-binding domain family III 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011024190.1.98848
Sequence length 1262
Comment cell surface protein [Methanosarcina acetivorans]; AA=GCF_000007345.1; RF=representative genome; TAX=188937; STAX=2214; NAME=Methanosarcina acetivorans C2A; strain=C2A; AL=Complete Genome; RT=Major
Sequence
MKKIHYVCMVALLSTMMLAVAPASATTWNVSTVSELQNAAANAGEGDTIFVHNGNYTLTS
TLYLYKSNITFTGESKEGVVLLRDNDFITIGSNGGPAPGCIVENMTLLGDITSTSGVFGI
SVRSPDCTLRNLILRDIRDCAVISSNSEDCSGLIISNCTFDNSGTENFAISILATNSIIE
NNVIKNNQYAYGPLCVQAQNVTVSNNLFMNNPYAFYLVYADNSLVSGNDMVSTGNILIYD
PGEAIVWQLNNFSESIVSNEWAGPLPSVSYWNSTEPIEYTYNGATYTGYPGNYWGAAYTG
TDADGNGIGDTPYEVPGGLGTDYSPLISPKENYEILETPVANFNAAPLSGNVPLEVRFTD
QSTGSGISSWAWDFDGDGNVDSTEQNPSHTYNSTGAYTVSLSVTGQLGSDSKTKADYITV
REPAEPPIADFSAEPLSGPVPLEVRFTDLSTGEGIDSWSWDFDSDGTVDSTEQNPTFTYS
EIGNYTVTLTVTGTGGSDSKVKTDYIVSEEAEPAFPTAGFSASSRDGAVPFTVKFTDSSE
NTIDWAWDFDNDGNVDSTEQNPLYTYYTEGNYTVKLTASNGNGSDVLEIPDMITVAPERP
ASPEDSWYQFHGKVGHLGYSENGPKANRTEWISEDVTDAIGSSSPVVAEGKVFVICGGAG
MEEETTGIVQLVALNESTGDITWNASIPETVYGSWASPAYDDGMVFTATGPELGCYNAET
GEKIWCFNDTVGTLGAVNGGPAIADGMVIFSDWDGHHYYCLDEDTGYLLWSFVVVGDAQS
VPAYADGKFYLTGWTYTQGYAYCVDATTGEQLWNINVERSFCGSPAYKDGVLYLTTYNFS
GDGDLFALNATDGSIIWQQTVQRTDSTPALAYGNVYVSGGCSGFSDKETYCFNATTGEPV
WSIPSIGDWTWSVAVADGLAYVGGYALDAFTGDVVWNSPYGGGTPALSDGMLFSIGSNKK
VYAFKDSLSSPVANFSADITSGNAPLTVNFTDQSAGSPTSWLWDLGDGENSTEQNPSHTY
TSAGNYTVNLTVENSAGTDFELKTDYIEVSEDSVATITLYFDPESSSVSENESTEVNIVA
SNFPAGFSGYNLTVALDDPAVAEIVDIEYPSWALITQNSSLPGTSIYLKTVDLEDSIKEG
AADVVLATLTVSGKESGSANLSIGVERLEDDSGDSIEPEFLTGKIEVALLSLLPDQEYAP
KDLDGDGLYEDLTGNGEFSFVDIVAYFHNMDWIEENMPVEYFDFNGNERIDFDDVVRMFA
MI
Download sequence
Identical sequences Q8TI47
188937.MA4309 MvR245 gi|20093098|ref|NP_619173.1| WP_011024190.1.98848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]