SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011024193.1.98848 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011024193.1.98848
Domain Number 1 Region: 536-869
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.1e-53
Family Quinoprotein alcohol dehydrogenase-like 0.0021
Further Details:      
 
Domain Number 2 Region: 1346-1519
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.88e-34
Family Quinoprotein alcohol dehydrogenase-like 0.0012
Further Details:      
 
Domain Number 3 Region: 353-447
Classification Level Classification E-value
Superfamily PKD domain 4.71e-31
Family PKD domain 0.00024
Further Details:      
 
Domain Number 4 Region: 1645-1727
Classification Level Classification E-value
Superfamily PKD domain 1.26e-27
Family PKD domain 0.00022
Further Details:      
 
Domain Number 5 Region: 1731-1816
Classification Level Classification E-value
Superfamily PKD domain 1.83e-27
Family PKD domain 0.00037
Further Details:      
 
Domain Number 6 Region: 12-353
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.49e-27
Family Galacturonase 0.049
Further Details:      
 
Domain Number 7 Region: 454-536
Classification Level Classification E-value
Superfamily PKD domain 9.94e-27
Family PKD domain 0.00025
Further Details:      
 
Domain Number 8 Region: 1022-1234
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.2e-26
Family Pectin methylesterase 0.013
Further Details:      
 
Domain Number 9 Region: 933-1018
Classification Level Classification E-value
Superfamily PKD domain 3.66e-24
Family PKD domain 0.00041
Further Details:      
 
Domain Number 10 Region: 1257-1384
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.18e-17
Family Quinoprotein alcohol dehydrogenase-like 0.015
Further Details:      
 
Domain Number 11 Region: 1458-1640
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000424
Family Methylamine dehydrogenase, H-chain 0.083
Further Details:      
 
Domain Number 12 Region: 883-933
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000102
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 
Weak hits

Sequence:  WP_011024193.1.98848
Domain Number - Region: 1975-2026
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00314
Family Type I dockerin domain 0.0098
Further Details:      
 
Domain Number - Region: 1832-1954
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0293
Family Cellulose-binding domain family III 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011024193.1.98848
Sequence length 2029
Comment cell surface protein [Methanosarcina acetivorans]; AA=GCF_000007345.1; RF=representative genome; TAX=188937; STAX=2214; NAME=Methanosarcina acetivorans C2A; strain=C2A; AL=Complete Genome; RT=Major
Sequence
MKKLTTVPIICIILLLMLAVAPVSAKTFDIYPTDPVGTVYTIMKTQAQPGDTLFFHAGTY
TYSGVLGTMDIDVENVTWKGEGADVVLFEISAGNPLKLKALGCIADGFTINISESTSVYI
TYPNCIVRDCVFKNMQGGRISVTDSGINSTVENNSFEDSTSSIIMYINGVNSAKVINNEF
ESSNAGSNAALYIRSAPMTTVADNTFKNNTKGSALMLRESTNCTVVNNTFLNDTNKVITI
YQTTAKNNIIMQNNIVSSGIPIRFENAGDGNKIFLNNFANTSGGMSGTPPAITYWNSTEP
MEYTYNGTTHTGYLGNFWGTAYTGSDGDGNGIGDISYTVPSSFGTDYAPLISTNENYGSS
ETHETPSAPVAGFSATPTSGNAPLTVNFTDQSTNTPTSWLWDFGDNSTDTEQNPSHVYAS
AGNYTVNLTVANADGSDSEVKTEYIVVSEPLSGAPVANFTANVTSGTAPLTVQFTDLSSG
DGITSWAWDFDSDGTVDSNEQNPIHVYNSTGTYTVSLTVTGDEGSDTETKTNYITVSETV
TESGWSQFQKDSSHTGYTFSSVPTQDPELLWQKLTSPEQEPCGSGGINVPSVISGNTVFV
TAGNASVWAFNKETGDLIWSKELGGDLTQTSTPALGNGTLFVPTMEGDLYAFDPENGNEL
WKAHITDGNLECPITYSDHKLYIGDGLEGGTGTKYYYCYDDSGNLVWQHENANTSGFLWS
GSVVVGDYLVYPVFEGKMVCLNKDTGTFVDEVDFSKSSDVSFALTDPGMFRGSVTYADGA
LYTSSERGQETGYCFKVGFNPDTGQFLDSGWAASIGFSTSTPVVYDGRVYVGHGEHGESG
ALFCLNDSDGTVIWETPVSGGVKSSPVISVEDGNPYIYFTEAIVDGSIYCLNPDGTLAWH
YNPPEDSAYTLQGAALSDDKVYYGTDNGYLYCIGQGEALPPEANFSSDKQTGSFPLTVSF
KDRSFNANKFFWDFGDGNTSTEVNPVHTYTAAGSYTVTLTVENNHGEDTKVVEDYIYAVK
VPTIWPVKSGGSIQAAINSADSGDIIKVYPGEYHEVLTIDKNLTLKGIRDPVLNASGFTG
SSGITISADDVEINGFEITGTEEMCFAITVNAKNALIEDNLIDNCAEGVMFTGTGNILRQ
NNISNCWDFAAVLDSTGDNRIYQNTFINNNGRKMGGSSDHISGGSGSFFQSPEPVEYLWE
GEKLTGYMGNYYDDYTGNNSDGDGIGDVSYTADGGTDQYPLVMPYSYYVEEQENESIPED
SWYQFHGKVDHLGYSESGPKTNRTEWVSEDIDAISSSSPVVAGGKVFVICGAGGMEESTD
DIPQLVALDEFNGDIIWNVSIPKAVYGSWASPAYDNGMVFTATGPELGCYDAETGEKIWC
FNDTVGSQGAVNSGPAIADGMVIFSDWDGSHYYCLDEDTGYLLWSFEVVGDGQSVPAYAD
GKFYLTSWGYGSSYAGHAYCVDAVTGEQVWHINNIEQNFCGSPAYKDGVLYLTTYNFYGD
GDLLALDAADGSIIWQQTIQRTDSTPAFAYGNIYVCGGCEGFSNVQTYCFNASTGEKVWE
TPSLTGEDGGIGGWTCSVAVADGLAYVGTEGNGYFGYNDLYALDAFTGEVVWHIPHAGST
PAISEGMLFSIGADQKVYAFKDSLTSPVANFSADITSGNAPLTVNFTDISTGTASSYAWD
FDSDGTVDSTEQNPSHTYTSAGTYTVNLTVANAEGSDSELKTDYITVSSTPVEPEPVAAF
TADVTGGTAPLTVNFTDQSTGTPTAWEWDFDNDGNVDSSEQNPSYTYNAAGNYTVNLTVE
NEAGMDFELKTDYIKVSETSGSTVTLYFDPESSSVAENESTEINIVASNFPAGFSGYNLT
VAFDDPTVAEIVDIEYPSWALITENSTLPGTSIYLKAVDGEDTVQAGAVDVVLATLTVSG
KEKGSANLSIGVDRLDDDSGNVIGPALLTGKIEVTLLSPLPDQEYAPKDLDGDGLYEDLT
GNGEFSFVDIVAYFHNMDWIEENMPVEYFDFNGNGRIDFDDVVDMFAMI
Download sequence
Identical sequences Q8TI44
MvR246 188937.MA4312 WP_011024193.1.98848 gi|20093101|ref|NP_619176.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]