SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011024196.1.98848 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011024196.1.98848
Domain Number 1 Region: 495-815,868-895
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.88e-38
Family Quinoprotein alcohol dehydrogenase-like 0.0025
Further Details:      
 
Domain Number 2 Region: 11-306
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.43e-33
Family Pectin methylesterase 0.085
Further Details:      
 
Domain Number 3 Region: 894-986
Classification Level Classification E-value
Superfamily PKD domain 2.49e-31
Family PKD domain 0.00027
Further Details:      
 
Domain Number 4 Region: 1336-1419
Classification Level Classification E-value
Superfamily PKD domain 4.71e-31
Family PKD domain 0.00028
Further Details:      
 
Domain Number 5 Region: 1247-1332
Classification Level Classification E-value
Superfamily PKD domain 8.89e-29
Family PKD domain 0.00035
Further Details:      
 
Domain Number 6 Region: 1151-1244
Classification Level Classification E-value
Superfamily PKD domain 2.49e-27
Family PKD domain 0.00032
Further Details:      
 
Domain Number 7 Region: 316-400
Classification Level Classification E-value
Superfamily PKD domain 3.53e-27
Family PKD domain 0.00026
Further Details:      
 
Domain Number 8 Region: 405-488
Classification Level Classification E-value
Superfamily PKD domain 2.22e-26
Family PKD domain 0.00053
Further Details:      
 
Domain Number 9 Region: 989-1075
Classification Level Classification E-value
Superfamily PKD domain 1.96e-24
Family PKD domain 0.00034
Further Details:      
 
Domain Number 10 Region: 1073-1143
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000222
Family PKD domain 0.00088
Further Details:      
 
Weak hits

Sequence:  WP_011024196.1.98848
Domain Number - Region: 1578-1630
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000412
Family Type I dockerin domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011024196.1.98848
Sequence length 1632
Comment cell surface protein [Methanosarcina acetivorans]; AA=GCF_000007345.1; RF=representative genome; TAX=188937; STAX=2214; NAME=Methanosarcina acetivorans C2A; strain=C2A; AL=Complete Genome; RT=Major
Sequence
MRKINYILIVLLSAVLVVIPASATTYYVDDDGGYDFTTINAALHATSVGDEVFVYNGTYN
NESNDIVQFYKSNTMLVGEGADVVTIDCNNKNAGIAVSIYTGCVVEGVKVVNSKFGIRLD
TSNHTVRDCVFDGMTYSDGTLMTDGADNCLFENNRLINSTGMYSAMSIYCHNSSILNNTF
TDNSGAGFTVCVQADGNIIAYNNFTSNGYAGIEFYSAGEGNKVYLNNFIGNGVTATTSGT
AVPALTYWNSTEPIDYTYNGATYSGHLGNFWGSAYTGTDADGDGIGDTPYTLPDGLGTDY
APLIAGYENYLHPNEPQDTPVANFSAVPLSGHAPLAVQFTDLSTGSPTAWDWDFDNDGNV
DSTEQNPSYTYNAAGNYTVNLTVTNAGGSDSEVKDAYIVVSESLPEDPVANFTATPTSGN
APLTVNFTDASTGTVSSYAWDFDNDGNVDSTEQNPVHTYVAEGNYTVSLTVTSAGGSNSE
MKPDYITVSKSYIPAEPGEDWPSFQKDIHNTGLTSDRGPITAPDEEVSWDVYTHGTGMAG
IDTVPVVVNGSVYVVSTDGYVRAINRTTGALNWETPIPDCSGFQLGNPAYGNGKIFVPTA
DSRIFAFDAWTGTELWNDSVESNKPSSSSLYHQLNTPVVYDNGRIYFGQWIPANYAGKYY
CYTEDGTEVWNRDCTNGNKGYYWAGATVVGDYLVFGGDDGYLTSLYKVNGTLVDEINIGA
GEIRSTLVYDEESNRIFTSTKNGYCISIEMNPEGTFNDSSKVQSASFDAQSTSTPVIYNG
RVYLGSGNFQASSPFFCLNSTDLSVIWRFTGTNGGIQSSPVVSTAYDDGDGEVYIYFTTN
ARYSRLYCLKDNATNTNMTSEEWYFQPEDSKNQYTLQGVALVGGWLYYGNDKGYLFGLAG
VQNGSEIPVADFNAAPLSGNSPLTVNFTDDSTGSPTSWFWDFGDGTNSTEQNPSYTYTSA
GNYTVNLTVANAAGSDSEVKTDYISVSEPLPSAPVANFSADITSGVGPLAVQFTESSTGS
PTAWEWDFNNDGNVDSTEQNPQFIYTGEGTYSVKLTVTNSEGNDSELKIDYISVVYPSPD
FIANVTEGTVPLTVEFTGNVSGLAPDYWNMWAWDVDGDGTYDYSPNFNITHTYTEPGTYD
VVVAYDGWTPNVKAGYITVLPEIPVANFSADVTSGLEPLTVNFTDQSEGIVSSYSWDFDN
DGTVDSIEQNPSYTYESAGNYTVSLTVSNAGGSDSELKTDYIVVSEPVPEAPVANFTATP
TAGNAPLTVNFTDQSEGIVSSYSWDFDNDGNVDSTEQNPSHTYESAGNYTVSLTVSNAGG
SDSELKTDYITVSSTPVEPEPVAAFTADVTGGTAPLTVNFTDQSTGSPTAWAWDFGDGAN
STEQNPSHTYVSAGNYTVNLTVENAAGMDFELKTNYIEVSETSGSTVTLYFDPESSSVSE
NESTEINIVASNFPAGLSGYNLTVAIDDPVVAEIVDIAYPTWALISENSTLPATSIYMKT
VDLEDAVKEGATDVVLATLTVSGKEKGSANLSIGVKRLEEDSGDSIEPALLAGTIEVTLL
SPLPDQEYAPKDLDGDGLYEDLTGNGEFSFVDIVAYFHNMDWIEENMPVEYFDFNGNGRI
DFDDVVRMFGMI
Download sequence
Identical sequences Q8TI41
gi|20093104|ref|NP_619179.1| WP_011024196.1.98848 188937.MA4315 MvR247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]