SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011032737.1.7314 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011032737.1.7314
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily Transposase IS200-like 3.27e-39
Family Transposase IS200-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011032737.1.7314
Sequence length 154
Comment IS200/IS605 family transposase [Methanosarcina mazei]; AA=GCF_000979915.1; RF=na; TAX=2209; STAX=2209; NAME=Methanosarcina mazei; strain=1.H.A.1A.1; AL=Scaffold; RT=Major
Sequence
MELNSFSHGYGQITYHLVLVPKYRYNIFYSKQIKKDCELILNNICIEQGYKLHALEIVDD
HVHLFVEFHPSNSLSEVIQYLKGGSSYRLFKLHPELKKRYWGGSLWSSGKFYRSVGNVTA
DTIKHYIKESQKKPKTEVKSSKSAKPDQRIIDDF
Download sequence
Identical sequences A0A0F8M9P1 Q8PYS3
WP_011032737.1.13133 WP_011032737.1.14209 WP_011032737.1.14583 WP_011032737.1.14776 WP_011032737.1.15587 WP_011032737.1.16878 WP_011032737.1.18729 WP_011032737.1.21267 WP_011032737.1.21501 WP_011032737.1.2157 WP_011032737.1.24179 WP_011032737.1.29103 WP_011032737.1.29761 WP_011032737.1.32345 WP_011032737.1.33522 WP_011032737.1.41322 WP_011032737.1.43564 WP_011032737.1.43834 WP_011032737.1.4739 WP_011032737.1.49674 WP_011032737.1.53089 WP_011032737.1.53770 WP_011032737.1.57580 WP_011032737.1.58691 WP_011032737.1.61670 WP_011032737.1.62876 WP_011032737.1.7135 WP_011032737.1.7314 WP_011032737.1.73216 WP_011032737.1.73711 WP_011032737.1.74065 WP_011032737.1.75785 WP_011032737.1.76299 WP_011032737.1.7642 WP_011032737.1.76508 WP_011032737.1.82623 WP_011032737.1.82674 WP_011032737.1.83034 WP_011032737.1.8430 WP_011032737.1.84394 WP_011032737.1.90340 WP_011032737.1.9066 WP_011032737.1.90871 gi|21226889|ref|NP_632811.1| 192952.MM_0787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]