SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011033831.1.57580 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011033831.1.57580
Domain Number 1 Region: 26-222
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-29
Family Voltage-gated potassium channels 0.0018
Further Details:      
 
Weak hits

Sequence:  WP_011033831.1.57580
Domain Number - Region: 212-258
Classification Level Classification E-value
Superfamily Multimerization domain of the phosphoprotein from sendai virus 0.068
Family Multimerization domain of the phosphoprotein from sendai virus 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011033831.1.57580
Sequence length 259
Comment potassium channel protein [Methanosarcina mazei]; AA=GCF_000980075.1; RF=na; TAX=2209; STAX=2209; NAME=Methanosarcina mazei; strain=1.H.M.2.3; AL=Scaffold; RT=Major
Sequence
MRKHMDKEQIQQERLDLLSQINEILDFPLILLSIVWLILIIVDFVYGLSSRLQTASTVIW
GIFIADFFVELYIAPKKKVYLKENWLVALSLFLPALRILKLFRGFRLFKLSSFIRSFNLA
RILSSFNRSIRTVRKAVRQRGLEYVLLLTALVTSIGAAGMYSFERPGLSSYWDAFWWTAM
IMTTIGSDYWPETFEGRILTFFLSVYAFAIFGYITAALASLLIGKEKEESSKEIVELRKE
VQRLSSEISRFSEKEKKQI
Download sequence
Identical sequences A0A0F8R1H2 Q8PVR4
WP_011033831.1.12270 WP_011033831.1.13133 WP_011033831.1.14209 WP_011033831.1.14583 WP_011033831.1.14776 WP_011033831.1.15587 WP_011033831.1.16483 WP_011033831.1.16878 WP_011033831.1.18729 WP_011033831.1.18783 WP_011033831.1.21267 WP_011033831.1.21501 WP_011033831.1.2157 WP_011033831.1.21629 WP_011033831.1.21918 WP_011033831.1.24179 WP_011033831.1.29103 WP_011033831.1.29761 WP_011033831.1.32345 WP_011033831.1.33522 WP_011033831.1.40449 WP_011033831.1.41322 WP_011033831.1.43564 WP_011033831.1.43834 WP_011033831.1.44090 WP_011033831.1.4739 WP_011033831.1.49674 WP_011033831.1.4970 WP_011033831.1.53089 WP_011033831.1.53770 WP_011033831.1.57580 WP_011033831.1.58691 WP_011033831.1.61041 WP_011033831.1.61670 WP_011033831.1.62876 WP_011033831.1.63409 WP_011033831.1.64722 WP_011033831.1.65224 WP_011033831.1.66913 WP_011033831.1.7135 WP_011033831.1.7314 WP_011033831.1.73216 WP_011033831.1.73711 WP_011033831.1.74065 WP_011033831.1.75484 WP_011033831.1.75785 WP_011033831.1.76299 WP_011033831.1.7642 WP_011033831.1.76508 WP_011033831.1.8229 WP_011033831.1.82623 WP_011033831.1.82674 WP_011033831.1.83034 WP_011033831.1.8430 WP_011033831.1.84394 WP_011033831.1.9066 WP_011033831.1.90871 WP_011033831.1.91617 WP_011033831.1.94933 WP_011033831.1.95514 192952.MM_1898 gi|21228000|ref|NP_633922.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]