SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011034627.1.61670 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011034627.1.61670
Domain Number 1 Region: 1-238
Classification Level Classification E-value
Superfamily NIF3 (NGG1p interacting factor 3)-like 3.92e-60
Family NIF3 (NGG1p interacting factor 3)-like 0.0000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011034627.1.61670
Sequence length 306
Comment Nif3-like dinuclear metal center hexameric protein [Methanosarcina mazei]; AA=GCF_000979495.1; RF=na; TAX=2209; STAX=2209; NAME=Methanosarcina mazei; strain=3.F.A.1A.1; AL=Scaffold; RT=Major
Sequence
MKLSKIVQVLEEIAPPEIADDFDRGRIGLILGLKDEVSKIAVALDANSCVLQKAAEIGAD
MLITHHTLIFHPVNVISKTLAASLKIALENEISLYSMHTNYDRAEGGINDVLAASLGLKN
ITTLELGRIGEIETCSTSELAAHVSDCLQTPVMYAGDRQEISRVMVAGGSCFRKEFLEIA
RENGVDAFISSELKHDVLREYEDLCLIDATHYATENPGMKALCPRLCELPGIEVEFIDQP
SGLRAVDFGSDMDGTVPDTNEETNDCKQKENEKDSLEFMLEEQSRNQIRSDYRRSLGSEN
RRRYLE
Download sequence
Identical sequences A0A0E3LWD0 A0A0E3PYI2 A0A0E3RXB1 A0A0F8HZP9 M1PC08 Q8PTJ7
gi|452211220|ref|YP_007491334.1| gi|21228820|ref|NP_634742.1| WP_011034627.1.12270 WP_011034627.1.13133 WP_011034627.1.14209 WP_011034627.1.14583 WP_011034627.1.14776 WP_011034627.1.15587 WP_011034627.1.16483 WP_011034627.1.16878 WP_011034627.1.18729 WP_011034627.1.18783 WP_011034627.1.21267 WP_011034627.1.21501 WP_011034627.1.2157 WP_011034627.1.21629 WP_011034627.1.21918 WP_011034627.1.24179 WP_011034627.1.29103 WP_011034627.1.29761 WP_011034627.1.32345 WP_011034627.1.33522 WP_011034627.1.40449 WP_011034627.1.41322 WP_011034627.1.43564 WP_011034627.1.43834 WP_011034627.1.44090 WP_011034627.1.4739 WP_011034627.1.49674 WP_011034627.1.4970 WP_011034627.1.53089 WP_011034627.1.53770 WP_011034627.1.57580 WP_011034627.1.58691 WP_011034627.1.61041 WP_011034627.1.61670 WP_011034627.1.62876 WP_011034627.1.63409 WP_011034627.1.64722 WP_011034627.1.65224 WP_011034627.1.66913 WP_011034627.1.7135 WP_011034627.1.7314 WP_011034627.1.73216 WP_011034627.1.73711 WP_011034627.1.74065 WP_011034627.1.75484 WP_011034627.1.75785 WP_011034627.1.76299 WP_011034627.1.7642 WP_011034627.1.76508 WP_011034627.1.8229 WP_011034627.1.82623 WP_011034627.1.82674 WP_011034627.1.83034 WP_011034627.1.8430 WP_011034627.1.84394 WP_011034627.1.9066 WP_011034627.1.90871 WP_011034627.1.91617 WP_011034627.1.94933 WP_011034627.1.95514 192952.MM_2718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]