SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011040970.1.15195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011040970.1.15195
Domain Number 1 Region: 18-131,187-318
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.32e-34
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011040970.1.15195
Sequence length 470
Comment FAD-dependent oxidoreductase [Colwellia psychrerythraea]; AA=GCF_000012325.1; RF=representative genome; TAX=167879; STAX=28229; NAME=Colwellia psychrerythraea 34H; strain=34H; BAA-681; AL=Complete Genome; RT=Major
Sequence
MMKQHLDALKDSKYCPLWHDQDIRPETLPALSADTSCELLIVGGGFTGLWGALQAKERQP
DADIILIEKTTISDGASGRNGGFLSSSLAHGETNTDHQFPGEADKLHQLGQQNLKEFIET
LEHYNIDARYEKVGETSVATDQASVDALRATYESEKAQGEDVVWFNQEEMQAQVNSPTYL
AGLWYRGGQDGVVDPARLCWGLKRVILELGVRIYEETPLTSLKKLGQDKMEVTCSDVKII
SDKVLMATNAYRNPIGQARRSIIPVWDYQIATQPLSQEQLDSIGWHKSRHALSNHANMFH
YYRFTKDNRITWGGGGAVRYYFNNGIDQSYADIPERFAQLSEEFFETFPQLKGIKFTHRW
SGIIATSTRFCVVPGVAYDGRVAWAIGYTGLGVGASRFGARIGIELLGYKPSEILDMQFV
KKKPIPWAPEPLRWIGVYLTHKALEKADANGGKRGLWLKLLDMLNLGFTC
Download sequence
Identical sequences Q48AQ0
167879.CPS_0095 WP_011040970.1.15195 gi|71281261|ref|YP_266863.1| CsR147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]