SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011041520.1.15195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011041520.1.15195
Domain Number 1 Region: 2-285,469-530
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.52e-89
Family FAD-linked reductases, N-terminal domain 0.0000963
Further Details:      
 
Domain Number 2 Region: 287-470
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.96e-39
Family GMC oxidoreductases 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011041520.1.15195
Sequence length 534
Comment choline dehydrogenase [Colwellia psychrerythraea]; AA=GCF_000012325.1; RF=representative genome; TAX=167879; STAX=28229; NAME=Colwellia psychrerythraea 34H; strain=34H; BAA-681; AL=Complete Genome; RT=Major
Sequence
MYNYIIVGAGSAGCVLAARLTENPNITVCLLEAGGPDKSVFIHAPAGVAAMLPTKINNWA
FETIPQKGLNGRKGYQPRGKTLGGCSSTNAMLYVRGNKWDYDNWSALGNKGWSYEEVLPY
FKKSEGNEYFSDQYHNQDGPLGVSNATAASNTNEMFIASCQEQGLKQNDDYNGAEQEGCF
MYQRTVKNGERCSAAKAFLTPHLNRPNLTVITHALTEKVLFEGKKAVGIRYKKDKKSVDI
HCDKEVILSGGAFGSPQVLMLSGVGPKEHLSDKNISLVHHLPGVGQNLQDHIDYIQTYRV
ASSDETFGLSLQGGTSMLKWMFEWKNKRSGKITSTLAESGAFFSTQDNVVAPDAQLVFVP
GIVDDHARKVNFGHGYSCHITVLRPDSTGEVKLNSSNPEDSLAIDPKFFDNDKDLDLIKR
GAKKMRAILESSPFDGIRQKLLFPLEKGNEHALEQDIRNRSDTQYHPACTCKMGTEYDAM
AVVDEQLKVHGLNGIRVVDASIMPKLVSGNTNAPTIMIGEKAADMILADYEDSQ
Download sequence
Identical sequences Q488U4
167879.CPS_0670 WP_011041520.1.15195 gi|71282351|ref|YP_267420.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]