SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011042283.1.15195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011042283.1.15195
Domain Number 1 Region: 15-66,127-277,369-426
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.17e-41
Family FAD-linked reductases, N-terminal domain 0.033
Further Details:      
 
Domain Number 2 Region: 279-369
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000000392
Family D-aminoacid oxidase-like 0.03
Further Details:      
 
Weak hits

Sequence:  WP_011042283.1.15195
Domain Number - Region: 84-144
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0249
Family CRAL/TRIO domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011042283.1.15195
Sequence length 427
Comment FAD-binding oxidoreductase [Colwellia psychrerythraea]; AA=GCF_000012325.1; RF=representative genome; TAX=167879; STAX=28229; NAME=Colwellia psychrerythraea 34H; strain=34H; BAA-681; AL=Complete Genome; RT=Major
Sequence
MSTVVDQEGNNKQQTVAVIGAGIIGINCALELQSLGYQVTLLDKEGIGLGCSKANAGHFA
TEQVFPLAEFSLLWQMPKLLFDPLGPVALSAKHFIKAIPWFMQFFNNMRPTLRNKNKKAL
QALNKNAIHHYTALLKAAEAEHLISLDGSLLVFETNDRTKVELMYQHYLAAGIAVKLLDK
RQTLELEPNLSNNINYSLYFTDVAHTIDPLALSKTLAEFAMCKGMTFQQTAVTSVTQTQS
GVTVEIDEQHLHVDHCVIACGAWSKKLLNGLNYHLPIEAERGYSLSLPISAAASALLSRP
VASAERRFIITPMGKTLRLAGTVEYAGLNAPANYKRAEMLKGNAAYILKRLPENEEKQEA
WMGCRPSLPDSLPVICQAPNHDKIFFALGHQHLGLTQGAITGKLIGQLVTGHSPEINIDP
FCIRRFN
Download sequence
Identical sequences Q485S6
CsR152 167879.CPS_1447 WP_011042283.1.15195 gi|71280545|ref|YP_268189.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]