SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011043036.1.15195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011043036.1.15195
Domain Number 1 Region: 5-259,359-436
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.34e-71
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00000000313
Further Details:      
 
Domain Number 2 Region: 453-588
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 1.07e-43
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00000113
Further Details:      
 
Domain Number 3 Region: 236-355
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.27e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.000000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011043036.1.15195
Sequence length 588
Comment succinate dehydrogenase flavoprotein subunit [Colwellia psychrerythraea]; AA=GCF_000012325.1; RF=representative genome; TAX=167879; STAX=28229; NAME=Colwellia psychrerythraea 34H; strain=34H; BAA-681; AL=Complete Genome; RT=Major
Sequence
MSVPIREFDAIVIGAGGAGMRAALAISESGKSCALISKVFPTRSHTVSAQGGITVALGNA
HEDHWEQHMYDTVKGSDYIGDQDAIEYMCKTGPESIIELEKMGLPFSRTEEGKIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHCLYQQNVKNKTNVYSEWYALDLVKNSDGAVVGT
TAICIETGEIVYFKARATVLATGGAGRIFASTTNAHINTGDGVGMSLRAGIQMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSMMTEIREG
RGCDGPWGPHIKLKLDHLGRETLYKRLPGVCDLSKTFAHVDPAEEPIPVIPTCHYQMGGV
PCNVNGQALNIGSDGKETIVEGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGNFLG
TYLNETQTATEASESDLEAALARTNRWESSTKGEDPVQIRKDLQMCMQMNFSVFREGEAM
AQGMKELTEIRERLSDARLDDKSSEFNTQRIECLELDNLMETAFCSAKAANFRTESRGAH
ARQDFTERDDVNWLCHSVYTPETEEMTKRDVNMKPVHREAFPPKARVY
Download sequence
Identical sequences Q482S5
167879.CPS_2217 WP_011043036.1.15195 gi|71279427|ref|YP_268942.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]