SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011044754.1.15195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011044754.1.15195
Domain Number 1 Region: 3-290,473-531
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.4e-89
Family FAD-linked reductases, N-terminal domain 0.0000715
Further Details:      
 
Domain Number 2 Region: 292-474
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.37e-61
Family GMC oxidoreductases 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011044754.1.15195
Sequence length 561
Comment choline dehydrogenase [Colwellia psychrerythraea]; AA=GCF_000012325.1; RF=representative genome; TAX=167879; STAX=28229; NAME=Colwellia psychrerythraea 34H; strain=34H; BAA-681; AL=Complete Genome; RT=Major
Sequence
MKTHLYDYIIVGAGSAGCVLANRLSEDGNSNVLLLETGGSDKSIFIQMPTALSIPMNSSK
YAWQFETEPEPFIDNRRMHCPRGKVLGGSSSINGMVYVRGHARDFDEWQQYGADNWDYAH
CLPYFKKAETWAFGGDEYRGNDGPLGVNNGNKMANPLYKAFVNAGVDAGYFSTDDYNGSQ
QEGFGAMHMTVKDGVRCSTANAYLRPAMTRKNLTVITHALVHKVLLENKTAVGIRYERKG
QVLDVKVNKEVILSAGSIGSPHLLQLSGIGAKNVLTEAGIETLHDLPGVGQNLQDHLEFY
FQFKCNQPISLNGKLGLWNKFLIGTRWILNKDGLGATNHFESCGFIRSKANVEWPDLQYH
FLPAAMRYDGKEAFAGDGFQVHVGHNKPKSRGSVNVASNDPKAPPKISFNYLEHEEDRAG
FRACVRLTREIIHQPALDEYRGEEIQPGAHIQTDEEIDAFVRSAVESAYHPSCSCKMGVD
DLAVVDPQTRVRGIKGLRVVDSSIFPTIPNGNLNAPTIMVAERAADLIRGLDTLAPSNEK
VDITPNWQQQQRPREATRNIK
Download sequence
Identical sequences Q47X03
WP_011044754.1.15195 167879.CPS_4010 gi|71278669|ref|YP_270668.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]