SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011050157.1.39696 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011050157.1.39696
Domain Number 1 Region: 744-958
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.27e-29
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.007
Further Details:      
 
Domain Number 2 Region: 67-213
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000706
Family Pyruvate oxidase and decarboxylase Pyr module 0.055
Further Details:      
 
Domain Number 3 Region: 458-646
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000801
Family PFOR PP module 0.063
Further Details:      
 
Domain Number 4 Region: 285-413
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000583
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.061
Further Details:      
 
Weak hits

Sequence:  WP_011050157.1.39696
Domain Number - Region: 1012-1116
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 0.0687
Family Tetrapyrrole methylase 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011050157.1.39696
Sequence length 1235
Comment MULTISPECIES: MFS transporter [Xanthomonas]; AA=GCF_001939965.1; RF=na; TAX=611301; STAX=346; NAME=Xanthomonas citri subsp. citri; strain=LM199; AL=Chromosome; RT=Major
Sequence
MTSTAALSSPDSANTPELGRVDADYTLDHKYTRTDGRIYLSGVQALVRLPLLQRLRDDAA
GLETAGFISGYRGSPLGGLDLELWRARKHLDAAKVTFTPGLNEDLAATMVWGTQQTNLFP
GAKVQGVYGMWYGKGPGVDRSGDVFKHGNAAGTSPFGGVLALAADDHACRSSTLPHGSED
EFVSAMMPILNPAGVQDILDMGLLGWAMSRYTGRWIGFKTIAETVESSASVNVDPFARTI
VLPEDFALPAGGLSIRWPDPPVDQEMRLHRYAIAAAQAFARANHIDKMVLDSPHARLGIV
TTGKSYLDVLQALEYLGLDAQACAQIGIRVYKVGMTWPLEPVGISAFAQGLEDIVVVEEK
KAFIERQMKELFYNWPASAGARPSIVGKYDEQGAWILPSTGELTPATIAAVIGRRILRLL
QSSTINTDSIQQRLRWMDAKEAEMALPRAQFPRVPHYCSGCPHNTSTAVPEGSRALGGIG
CHYMVTWMNRATDTFTHMGGEGVTWSGQAPFTGTPHVFQNLGDGTYFHSGSLAIRQSVAA
GVNITYKILYNDAVAMTGGQPVDGTLTVPDIAHQLRAEGIHEIAVVSDDIGKWTRRRDLF
PPEVAFHDRGELDAVQQHLRTVKGVSILIFDQTCATEKRRRRKRGKLIDPPKRVMINSLV
CEGCGDCGEKSFCVSVLPKETEFGRKRQIDQSNCNKDYSCVSGFCPSFVTVHGGAPRKGK
RRDASTLLDALPEPPRRTTLERPWNILITGVGGTGVVTIGALLGMAGHLEGKGATVLDQT
GLAQKGGAVTTHIRIARQPADIHAVRIAAGEADLVLGCDMVVVNDYWALSKVRDGRTQVV
LNTYEAMPGTFTTQPDLQFPAAEIIAGVRTALGGQEPLLLDATQLATALLGDAIASNLFV
LGYAWQHGLVPLSHAALMRAIELNGAAVAMNQQAFAWGRLAAIDLPAVQRAAGLAGADAP
AHLHGDTPYARGPGSWEEHDLSGQSAPRALAQTDGSTLHGEVAAPAAPLDDEQLAHSLDE
AIARRVAFLTDYQDAAYAQRYRSLVERVRTHELQRAPGSNALTEAVARYAFKLMAYKDEY
EVARLYTRGDFQRRLQQQFEGDYTLRFHLAPPLLAKKDAHGNLIKREYGPWMFTAFKLLA
RLKFLRGGKLDVFGYSEERRGERQLIADYSATVHMLLERLDADNVGLAAQIASIPEHIRG
YGHVKHAHLQEAKAREAALLAQWRNPKALHVVQAA
Download sequence
Identical sequences A0A0U5BWZ6 M4TNM1
gi|470470119|ref|YP_007634687.1| WP_011050157.1.13350 WP_011050157.1.19505 WP_011050157.1.21004 WP_011050157.1.22109 WP_011050157.1.22678 WP_011050157.1.28779 WP_011050157.1.30778 WP_011050157.1.31392 WP_011050157.1.35047 WP_011050157.1.35540 WP_011050157.1.37228 WP_011050157.1.38217 WP_011050157.1.39696 WP_011050157.1.43799 WP_011050157.1.43832 WP_011050157.1.46272 WP_011050157.1.47697 WP_011050157.1.47707 WP_011050157.1.53417 WP_011050157.1.56804 WP_011050157.1.58382 WP_011050157.1.6260 WP_011050157.1.63386 WP_011050157.1.6829 WP_011050157.1.70193 WP_011050157.1.71126 WP_011050157.1.71284 WP_011050157.1.72810 WP_011050157.1.76206 WP_011050157.1.80421 WP_011050157.1.80602 WP_011050157.1.82073 WP_011050157.1.87455 WP_011050157.1.88516 WP_011050157.1.88706 WP_011050157.1.88988 WP_011050157.1.89206 WP_011050157.1.90138 WP_011050157.1.90200 WP_011050157.1.90226 WP_011050157.1.92041 WP_011050157.1.92912 WP_011050157.1.94705 190486.XAC0189 gi|77748518|ref|NP_640545.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]