SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011059979.1.76993 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011059979.1.76993
Domain Number 1 Region: 7-100
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.12e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011059979.1.76993
Sequence length 101
Comment MULTISPECIES: anti-anti-sigma regulatory factor [Pseudomonas]; AA=GCF_001547895.1; RF=na; TAX=1500686; STAX=1500686; NAME=Pseudomonas sp. Os17; strain=Os17; AL=Complete Genome; RT=Major
Sequence
MSVVTEISPDGQKLTISIRGRFDFGRHQEFRESYERLNRTPESIVVDLKEATYLDSSALG
MLLLLRDHAGGDNADVRVINSNSDVRKILAISNFDKLFDIS
Download sequence
Identical sequences A0A0D6BEG1 A0A0W0P3Q4 A0A1H4YEW7 A0A1K1ZBF9 A0A2C9EIN7 A0A2K2WX93 Q4KG64
gi|501679147|ref|YP_007998973.1| gi|70729035|ref|YP_258769.1| WP_011059979.1.100210 WP_011059979.1.101844 WP_011059979.1.11424 WP_011059979.1.12653 WP_011059979.1.14038 WP_011059979.1.1721 WP_011059979.1.18072 WP_011059979.1.21308 WP_011059979.1.23266 WP_011059979.1.27351 WP_011059979.1.29261 WP_011059979.1.38500 WP_011059979.1.39301 WP_011059979.1.41899 WP_011059979.1.42452 WP_011059979.1.42693 WP_011059979.1.462 WP_011059979.1.46426 WP_011059979.1.46796 WP_011059979.1.48506 WP_011059979.1.49818 WP_011059979.1.58641 WP_011059979.1.58795 WP_011059979.1.62026 WP_011059979.1.6225 WP_011059979.1.64508 WP_011059979.1.6649 WP_011059979.1.67749 WP_011059979.1.74391 WP_011059979.1.76749 WP_011059979.1.76969 WP_011059979.1.76993 WP_011059979.1.79484 WP_011059979.1.81001 WP_011059979.1.81277 WP_011059979.1.83211 WP_011059979.1.88821 220664.PFL_1643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]