SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011061032.1.83211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011061032.1.83211
Domain Number - Region: 118-214
Classification Level Classification E-value
Superfamily vWA-like 0.00145
Family Integrin A (or I) domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011061032.1.83211
Sequence length 313
Comment MULTISPECIES: DUF58 domain-containing protein [Pseudomonas]; AA=GCF_001906625.1; RF=na; TAX=380021; STAX=380021; NAME=Pseudomonas protegens; strain=PA11; AL=Scaffold; RT=Major
Sequence
MTQPVAEPGIRITLGELIEMRHRVREVQLFSTPSQRSPLIGLHHSKLRGRGVDFDQVRVY
QAGDDVRTIDWRVTARTQEPHTKLFHEERERPIFIMVEQSRQLFFGSGLMFKSVLAAQAA
SLIGWAALGHNDRVGGLVYGDDEHYEIKPRRSKQSLLQLLNRLVRVNQSLHSEARPQRDA
LGTALLRGREVLRPGSLVIVICDERALSDAAEQQLSLLSRHCDLLLMPLSDPLDHALPAA
GLLRFAERGAQLELDTLNYDLRQAYRAMSEARIARWERLAQKLRVLLMPLSTQSEMVEQL
REYLNPQRPGAGR
Download sequence
Identical sequences A0A1K1UP88 A0A2C9ELP2 A0A2K4LM13 Q4KD38
gi|501680245|ref|YP_008000071.1| 220664.PFL_2738 WP_011061032.1.100210 WP_011061032.1.101844 WP_011061032.1.11424 WP_011061032.1.12653 WP_011061032.1.14038 WP_011061032.1.1721 WP_011061032.1.18072 WP_011061032.1.21308 WP_011061032.1.23266 WP_011061032.1.27351 WP_011061032.1.38500 WP_011061032.1.39301 WP_011061032.1.41899 WP_011061032.1.42452 WP_011061032.1.42693 WP_011061032.1.462 WP_011061032.1.46426 WP_011061032.1.48506 WP_011061032.1.49818 WP_011061032.1.58641 WP_011061032.1.62026 WP_011061032.1.6225 WP_011061032.1.64508 WP_011061032.1.6649 WP_011061032.1.67749 WP_011061032.1.76749 WP_011061032.1.76969 WP_011061032.1.79484 WP_011061032.1.81001 WP_011061032.1.81277 WP_011061032.1.83211 WP_011061032.1.88821 gi|70730106|ref|YP_259845.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]