SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011063024.1.46426 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011063024.1.46426
Domain Number 1 Region: 129-195
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9e-22
Family Cold shock DNA-binding domain-like 0.00028
Further Details:      
 
Weak hits

Sequence:  WP_011063024.1.46426
Domain Number - Region: 37-122
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0667
Family ABC transporter transmembrane region 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011063024.1.46426
Sequence length 201
Comment MULTISPECIES: cold-shock protein [Pseudomonas]; AA=GCF_001904985.1; RF=na; TAX=380021; STAX=380021; NAME=Pseudomonas protegens; strain=PA25; AL=Scaffold; RT=Major
Sequence
MLKIVHLLTGIAALLLSLIPSLRSDAVPYLQQPDALYLALFGLLNLILAPVIPYWNKGSR
HHLQNLVSALLVLVVVLQTLTLLAPMPVIGGQPAVLVSLLTALIAVVLHLAISFYKSSPS
ASATPSYDMSNRDTGTVKWFNTSKGFGFISRDSGDDIFVHFRAIRGEGHRVLVEGQRVEF
SVMNRDKGLQAEDVIAALPRR
Download sequence
Identical sequences A0A2C9ES64 A0A2K2WZC1 Q4K7D2
WP_011063024.1.100210 WP_011063024.1.11424 WP_011063024.1.12653 WP_011063024.1.14038 WP_011063024.1.1721 WP_011063024.1.18072 WP_011063024.1.21308 WP_011063024.1.27351 WP_011063024.1.39301 WP_011063024.1.41899 WP_011063024.1.42452 WP_011063024.1.42693 WP_011063024.1.462 WP_011063024.1.46426 WP_011063024.1.48506 WP_011063024.1.49818 WP_011063024.1.6225 WP_011063024.1.64508 WP_011063024.1.6649 WP_011063024.1.67749 WP_011063024.1.76749 WP_011063024.1.79484 WP_011063024.1.81001 WP_011063024.1.81277 WP_011063024.1.83211 WP_011063024.1.88821 220664.PFL_4770 gi|70732095|ref|YP_261851.1| gi|501682178|ref|YP_008002004.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]