SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011063832.1.58641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011063832.1.58641
Domain Number 1 Region: 252-348
Classification Level Classification E-value
Superfamily vWA-like 0.0000845
Family Integrin A (or I) domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011063832.1.58641
Sequence length 424
Comment MULTISPECIES: hypothetical protein [Pseudomonas]; AA=GCF_900119575.1; RF=na; TAX=1566211; STAX=1566211; NAME=Pseudomonas sp. NFPP09; strain=NFPP09; AL=Scaffold; RT=Major
Sequence
MSYVIDRRLNGKNKSTVNRQRFLRRYRDHIKKAVEEAVSRRSITDMEHGEQISIPGRDID
EPVLHHGRGGKQTVVHPGNKEFTAGEHIARPQGGGGGGGGRGKAGNSGEGMDEFVFQITQ
EEFLEFMFEDLELPNLVKRNLTGTDTFKTVRAGISNEGNPARINIIRTLRSAHARRIALS
GSSRAKLREAKEELARLKREEPDNFGDIQELEAEIERLSARIHRVPFLDTFDLKYNLLVK
QPNPSSKAVMFCLMDVSGSMTQATKDIAKRFFILLYLFLKRNYDKIDVVFIRHHTSAREV
DEEEFFYSRETGGTIVSSALKLMQEIMAERYPSNEWNIYAAQASDGDNWNDDSPICRDIL
INQIMPFVQYYTYVEITPREHQALWFEYERIAEAFSDTFAQQQLVSAGDIYPVFRELFQR
RLVT
Download sequence
Identical sequences A0A1K1ZS30 A0A2C9EUH9 A0A2K2WRX8 Q4K4X0
WP_011063832.1.100210 WP_011063832.1.101844 WP_011063832.1.11424 WP_011063832.1.12653 WP_011063832.1.14038 WP_011063832.1.1721 WP_011063832.1.18072 WP_011063832.1.21308 WP_011063832.1.23266 WP_011063832.1.27351 WP_011063832.1.38500 WP_011063832.1.39301 WP_011063832.1.41899 WP_011063832.1.42452 WP_011063832.1.42693 WP_011063832.1.462 WP_011063832.1.46426 WP_011063832.1.48506 WP_011063832.1.49818 WP_011063832.1.58641 WP_011063832.1.62026 WP_011063832.1.6225 WP_011063832.1.64508 WP_011063832.1.6649 WP_011063832.1.67749 WP_011063832.1.76749 WP_011063832.1.76969 WP_011063832.1.79484 WP_011063832.1.81001 WP_011063832.1.81277 WP_011063832.1.83211 WP_011063832.1.88821 gi|501683014|ref|YP_008002840.1| PlR56 gi|70732942|ref|YP_262713.1| 220664.PFL_5654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]